Jessy's blog

i'm gonna blog.

2010-12-07T22:24:00.002+08:00

BOO. backkkkk. :D

aiyo this blog so rusty and dirty.

like someone's hair. LOL

ermmmm, i'm very happy today. thats why i blog! :D

JAMES CHONG forgiven ME WEI.

SORRY FOR THE LAST TIME.

ermmmm, i wanna watch repunzel. and i can wait till next week

BTW, digital lifestyle fair 2010, 10 11 12 dec at KLCC, come! suuport AKAI. :D

i know you want it.

today i had fun with shu shu. i PLAYED THE DANCING MACHINE TAU.

and she's damn good wei. sexy tau ;D

ermmm, i saw ban ban's performance too. :D not bad not bad.

wait for it kay ban :D

had dinner with liyen's family.

i like whye. :D HAHAHA.

he is so grumpy weiii. so cute.

and i cant talk to joel's sis. D: SAD

he's not worth it. forget him. golden words from didi.

OH YEAH, i highlighted my hair with helen :D

got one picture we look alike hahaha.

my blog's song damn nice kan.

and i have a lot of DIDI :D

2010-10-09T20:49:00.002+08:00

i think i know what to do...

but not now.

2010-10-04T23:56:00.001+08:00

Jia you! :D

i'll NOT be sleeping today. just for you :D

omg. i can do this.

nah, yen. updateeeee. :D

fdngvjdfvndjgnsdlkndgfjkdsnasdlksnfklfdsgvnmvilycdsmnjgfngfjg.

caplico stick

2010-08-21T19:27:00.005+08:00

iloveyou.

:o WHAT WAS THAT. if one day you found out, great job. hahaha.

So erm i'm kinda hungry right now. BUT BUT...

i insist to blog!

you malay, selamat buka puasa!

hehe. i am NOT a racist bastard kay.

i ate a caplico stick just now. TASTY SHIT.

its so tasty until i took one. :D

yup not funny.

SO ERM f3s, still fbing?

DOTAING? MGING? slacking? haha

you better get SMAO.

study.

my.

ass.

OFF.

ONE MORE MONTHHHHHH. hahahah. good luck (:

dear, you can do it.

Let me introduce little cute shit here.

ITS SO HAIRY,

until you gonnnnnna DIE.

eh die is a hk drama toooooo.

YUP YUP.

tada, i call it helen's little SHIT.

i'm not sure whether it will blink in ma blog. lets just seee. i hope it willllll. hahahha. omg i love hairy stuff. but, definately not on the ear. (:

I have a huge carve for.

APA KHABAR KUCING.

yup. thats it!

hellllllo KITTY.

i love it so so so so so KITTY.

When i was two, i was IN LOVE with her.

She is sooooooooooooooooo BEAUTIFUL.

oh my god.

i know right.

Together, we make one heart.

not two heart. ONE heart. lol.

Thanks for telling me you went cc today. proud of ya. (: hahha.

This few weeks, we kept fighting right?

hate the feeling. SO MUCH.

i'll not text or call or pick up or chat or skype him, promise.

i won't break it.

i want you to trust me :D.

DO YOU KNOW WHOS COMING TMR? hahahaha

OU. 6PM. 22 august. xoxo

LEE HOMMMMMMMMM.

*OMFG, i know right*

althought his 34 already, he is still so HOT.

i like his style. artistic.

all his songs are so him. yup yup, its trueeeeeee.

SEE YOU THERE (: oh yeah, tell you next time whether love in disguise is nice.

I HAD A HARD TIME booking online.

ended up calling for reservationnnn.

HAHAHAHAH. YEN. HAHAHAHHA.

i'm ACTUALLY reading a boook. a novel.

its called. a walk to remember.

i'm just at the 10th page. YA LA slow poke la.

I WANT THIS. T.T do you know that its 3kkkkkkkkkkkkk? hhahaha.

yup yup. its like 2 cheap lv bags. TUT.

this hello kitty. looks creepy. maybe because the nose is freaking silver. LOL

hahaha dear, cook me this? (:
or this. LOL.
hahahhaha. ok i rather you cook an egg now. hahaha.

Ehhhh, i know its getting boring. hahaha. i dun care. continue read. :D

i like her so muchhhh. :D dream baby. hahaha.

i dun really like this. but erm since its pink, youre in the post. HAHA

BAI BAI :D

jess signed off.

revive :D

2010-08-10T12:44:00.002+08:00

wokay. I'M GONNA REVIVE MY DROP DEAD BLOG.

hahaha by drinking revive. (:

eh you better laugh. hmmmmm, yes i skipped school again. cos i was really haeadache.

owh YOU KNOW RIGHT, i actually fainted in front of uptown maybank ytd?

and my mama sawwwww. so i'm okay i think. :D he was so worried and said he almost called my mama to check me outtttt.

do you know why M&M don't want to study?

BECAUSEEEE they dont wanna be SMARTies. :D

hahahahahahha. ss betul. this joke is credited to megan. and also liyen because she laugh along. ahahah.

Liyen ditched me for low low ytd. because she was sickkk. *cough*

eh yen, this the the reason i told low low. then even he DOUBT. LOL.

low low is kinda cute sometimes. he tends to make jokes. some are so not funny until you could LAUGH LIKE SHIT cos its not funny. GET ME?

this blog has so much ermmmm good and bad memories. could i have you to forgive me?

Last saturday, YE SALES was awesome YO. :D

it was so fun andddd tiring! free mcd food btw.

thanks for friends and family who came.

Thanks dear. (:

PINK HIPPO lalalalla.

like the name? yup yup. i know right. hahaha.

Blood drive 2010 was ytd. we didnt promote it well this year. SO. ITS. kinda. fail :O

35 pints. But thanks to the people who donated. you saved LIVEsssss. :D

Thanks for the members who came for duty. We appreciated your effort.

Those who didnt come for duty, pandai pandai lah kay.

you know what DO boon will do. :D we will wait.

I love him (: yup omg. PMR coming? good luckkkk peeps.

eh another week of holiday for us f4s. YEAPY. hahahha.

another joke. do u know what is a joke? U.

ummmmm, not funny.

joel is retarded enough to know whats chu chu. :O YEN. olivia here. i'm not retarded kay. LOL.

Happy bday, ritchie. sorry i'm not in school. but ummmmm, have a blast one. and thanks for being a nice gor. hahahha. CHARMING :O

He don't want me to talk to you anymore tho. but i hope if i'm honest with him, he will understand.

yup i hope i know that jealousy is BULLSHIT. hahaha. but u know. i'm a girl. hahahaha.

hmmmmmmmmm. CIAOMIAO actually originated from megan toh. :D

kay ciaomiao yo!

WT: Bye.

Me: erm bye?

WT: say bicycle.

Me: ummmmm bicycle.

WT: Lets go.

:O She is so into KHJ. my god. but his songs are not-bad-la. ahahah.

i'm wearing the greeeen shirt. the leaf.

kay this is the real CIAOMIAO. gonna batheee. studying with him ltr.

jess signed off. (:

2010-05-25T23:09:00.004+08:00

opps. i dint talk to you?

oh ok.
hurts so much right?

it feels exactly the same when you ignore me.
just worse.

you ignore me for a whole month.
i ignore you 2 weeks.

hmm.
oh, too bad then.

why bother talking to me?
need to make use of me even more?
need a person to buy you espirit?
need a person to teman you from mcd?
need a person to run around like a retard for you?
need a person to help you study?
need a person to accompany you till late night?
need a person to buy ferero for you?
need a person to solve problems for you?
need a person to starve to save money for you?

need someone to use?
Oh, there he is.
your boyfriend. :)
ask him to talk to you.

since he knows you so well. :)

im only a tool.
ask me help you , i sure help you one.
dont worry to care about my feelings. im only a tool.
:)

dont even freaking care about me.
i dont want to even talk to you.
you spoil my mood all the time.
bye. (:

My biggest Mistake

2010-05-05T20:18:00.002+08:00

It was my biggest mistake ,
To take away your privacy ;
But my heart seem to ache ,
Or maybe I'm just going crazy.

I'm really sorry my dear ,
For being so cold ,
But I only want to know ,
If I am really the one you want to hold.

Although once you said you loved me ,
I always thought I would be happy ,
I'm always filled with jealousy ,
I need to get rid of the uneasy.

Jessica , I love you truely ,
Thats is why I feel so badly ,
I would do anything ,
Just to make you say "its nothing."

It is my biggest mistake ,
To make you feel annoyed ;
Perhaps it's time for me to change ,
So that we will love again and be overjoyed.

The more I think of you ,
The more I'll miss you ;
For you , I've been sacrificing,
Just to let you know...
you're adoring.

fmr,
jc.

Red Infusion

2010-05-01T10:45:00.004+08:00

red infusion was awesome. i think.
jessica did alot of work deco-ing the hall. hahaah.
all the glitter on the floor. walao. hahahahaa. damn hard to come off.

hmm..
jessica dint dance. i pull her also she dun wanna dance.
hahahah. maybe she is still angry.

the food was funny.
in the end there was a whole bunch of mihun there. and i had to take it back. gosh, hahaha.
shin yen was stressing over the leftover food. hahaaha.

=( oh well.

bye peeps.

why do you only talk to me when you want something?
=(
I really want to chat with you like how we used to chat in march
i really love you , jessica. im sorry for not trusting you.
gosh, it hurts alot. 1 week not talking to me feels like a month. every night i would think of you before i sleep. and the thought of you being angry makes me feel so painful.

2010-04-18T02:10:00.001+08:00

Friendship isn't always easily described. The Eskimos, they say, have a hundred different words for snow. Unfortunately, the English language isn't quite as innovative, though it has vast opportunities to differentiate meaning. Certainly, Love is one of those opportunities. And so, too, is Friendship.

Instead of different words, however, we're stuck with simple adjectives. Close friend. Best friend. Childhood friend. Intimate friend. Trusted friend. Beloved friend. But whether you use adjectives or different words, few could deny the nearly infinite meaning in such a simple word.

Friends are special people. We can't pick our family, and we're sorely limited in the number of them at any rate. Society and mores (and often our own conscience) dictate we select a single mate. But our friends can be as diverse and infinite as the adjectives we choose. Our friends, in a very real sense, reflect the choices we make in life.

2010-04-18T01:26:00.002+08:00

In A Whirl...

Her raven tresses lay soft & sure
Like a waterfall, so clear, so pure,
Upon her shoulders, snowy white
Like the moonlit glow on a winter's night.

Her eyes alight with passion anew
Like the meadows glittering morning dew,
Burn deep into my heart & mind
Like a Summers day her beauty shined.

Her touch so gentle, velvet hands
Like the deserts rolling, warming sands,
Sends tingles through my very soul
Like an Autumn days romantic stroll.

Her heart so fragile yet warm & strong
Like the Larks most enchanting song,
Causes me to stumble & fall
Like a baby's first attempts to crawl.

Her very being excites me so
Like a fairground ride, my senses glow
She'll be forever my model girl
And I'll be forever in a whirl..

2010-04-17T00:55:00.002+08:00

everynight i say ily to you , you dont reply.
i never broke my promise.

this is abit yukma. but i know , you wont like it.
but i dont care.

you changed alot.
more hot guys are around you.
you dont really care much.

if i never told you i was hurt.
you wouldnt know.
and would continue to ignore me.

because youre too carefree.
and.
erm.

lol. this sounds damn funny.
i would rather you to be the nerd jessica with tied hair and glasses.

i dont mind if youre not pretty or beautiful.
because i love you for what you are.
(:

lol. hahaaahha.
ok you can go sleep now. :P see you tmr.

Hola people

2010-04-12T20:38:00.002+08:00

Hey there

since this female human is too busy to update her blog

i help her to update xD

so erm... hi

I hecker

2010-04-11T18:17:00.002+08:00

Alo

i hecker

i is able to heck into her acc coz i pro ma

i'm a stranger

so no wan no me

i dun wana tell oso

no one can catch me

and bit me

haha bluek

bai bai :D

-updatey by hecker99

2010-04-11T12:33:00.000+08:00

youre ignoring me.

thats why.

2010-03-19T23:18:00.001+08:00

If I had to live my life without you near me
The days would all be empty
The nights would seem so long
With you I see forever oh so clearly
I might have been in love before
But it never felt this strong.

Our dreams are young
And we both know they'll take us
Where we want to go

Hold me now
Touch me now
I don't want to live without you

Nothing's gonna change my love for you
You ought know by now how much I love you
One thing you can be sure of
I'll never ask for more than your love

Nothing's gonna change my love for you
You ought know by now how much I love you
The world may change my whole life through
But nothing's gonna change my love for you.

If the road ahead is not so easy,
Our love will lead the way for us
Like a guiding star
I'll be there for you if you should need me
You don't have to change a thing
I love you just the way you are
So come with me and share the view
I'll help you see forever too

These lyrics are for you , dear.
:)

iloveyousomuch.

this is not jess. lol.

2010-03-13T00:55:00.001+08:00

hehe..sm is asleep now. she asked me to revive her blog. :O
7up revive. :D omgimlame. I KNOW. :D

Hmm...
This woman is gonna be busy tmrrrr. Got so many things lehhh. :X
Got party den got so many things. Wah. Not bad not bad. :D

Hope you have fun tmr. :)
Hahahaha..
Sorry sm for going for the game. :O
Once in a long time only we play one lehhh.. Thanks for understanding also.

Hehe. omg im so sleepy. ciao. :)

Ok. I am not gonna send those sms again. :D hahaha.

Nice body? nehhhh.. :P

2010-02-24T14:51:00.002+08:00

since my sm so good , make time to sms although she busy.
I might as well "membalas jasa". :D

LOL. She said im awesome. tsk tsk. Youre more awesome! :DDD
Honoured anot! :D
HAHA.

Jessica : its so pretty la.

WEEE. Thanks for appreciating it. lol.
She even wore it to tuition. :)))
Thanks.

Anyway , this woman is so busy until she have no time to update her bloggyyy.
She got ed board la. bsmm la. ye la. LOL. haha. and tuitui.

erm. lazy d lar. ciao

2010-01-22T21:52:00.004+08:00

JESSICA CHAN WEI HUA IS A SMART ASS. and she's damn hyper, at almost all the time. dont you agree? ;D

i'm here to update for this lazy human. and she's at the other side helping me to update mine. uh huh, i know, its kind of lame, but its not funny, dont laugh. Lol. its er... cool. (it's her idea btw, blame her)

according to jameschong, from SMKDU: people like me and jess laugh at weird things, and that's why we're 'ngam key'. but he just dont wanna accept the fact that he's also one of the weird human out there. :D HAHAHA, admit lah jamey. ;)

we laugh at things like:

yen: jess, you still having flu?

jess: erm. *suck* *the sound of the nose* no more.

yen: HAHAHAHAAHAHA. lmao. [yeah and jess also laugh with me, because she realize she did something very funny that makes me laugh till my stomach pain] holycow. LOL.

omg now the sound of jess's nose is in my brain. get out get out. haha! :DD

owhyeah and dont see small jessica, she can run very fast. like me. *ahem*

GEEGEE.COM,

wongliyen. (:

8D

2009-12-30T22:28:00.002+08:00

ahemmm. of course i didnt get 8Ds.
8A8A8A8A8A8A8A8A8A8A8A8Asss. woohooo. (:
weeheee. in yr face, pmr! XD

erm ermmm those who didnt get straight A's, dont be sad. its not 2012 yet.
whats done is done. so try harder next time.

peeps who got straight A's, WOOHOO hi5 backkwardss (: congrats. u all deserved it :DDD

peterchao. facebook. nenebubu, he doesnt get fb. hahha. why do u always wear sunglasses? they are cool. but stilll. whats behind the sunglasses? issit something evil? *winkwink* nehhh. maybe there's just some eye shit. (:

happy chinese new year and ermmm i miss shushu.
why aren't you on9? or on-ing skypeee. or ermmm. FB? )):

DBSKKKKKK
& SNSD
current fav bandd. (:

oh right my mom sprang her spine. after the injection, she felt relief. and shes fine right nowww. but shes walking slow. so-not-mamachan. she walks SUPER fast last time. like wind. nono likeee fishh. :D

yay i updated and school's gonna reopen for the next few dayss. 4 more days? OHMANN.
no worries. BMBIBCBIOCHEMPYSAMMMMORAL. yeahhh good luck f4s. we are so gonna fail for the 1st exam. geegee.com

igtgciaomiaoo. nights.

jess signed off.

Lala.

2009-12-16T01:02:00.002+08:00

Hello peeps.
I am Jessica!!
Wait.
Of course im jessica. DUH. :D

What happened to my blog? - Jessica

O_O

What?

Never seen eyes these big before?

O_O <--- Have ANOTHER ONE.
:D

Omg. What am I doing?
LOL.
I am doing this at 1 o clock midnight. =O

My eyes are O_O|

HAHAHAHHAAHAHAHHA.
She left it dying.

Haiyo.
IT is crying for attention, Jessica.
YOUR BLOG!

It cant be updated all the time by your damn-bloody-freakass-cool sm right?
:DDDDDDDD

Wait. Im jess.
Im jess.

Jessica is ME.
HHAAHAHAHHA.

==

Joke of the day : Why did the chicken cross the road?
Answer : Thats because people eat the chicken.

Your reaction : O_O
My reaction : ;D
Your reaction after my reaction : _|_ <---- Middle finger
My reaction after your reaction after my reaction : :DDDDD

Lalalala. Spam spam spam.
SPam spam.

SIEN AR.
BYE.

2009-11-07T16:43:00.004+08:00

i abandoned you. i let u continue rotting. rot rot rot.
i didnt have a look at you since long long time. okay laa. maybe few weeeks nia.
haha. i'm talking about

my blogggg.

LMAO. hmmm was busy dis few weeks.

i am working at PJ ORTHODONTIC SPECIALIST CLINIC. *clapclap*

my first job of my life.

my first experience of working.

my first experience of earning money by my own. (; yay me.

and yesss. WOOHOO! i got my pay yesterdayyyy. teehee. (x
$$

Jess: "doctor ar, can i get my pay todayy. i need to use them."

[ come on come on, say yes! *gasps*] and yes this conversation was during work.
while he was bonding someone's teeth. lmao lmaooo.

dr. lee: "pass me the weingart."

[ oh shit, he didnt hear me?] the patient was laffing. LOL
whats so funny? -___________- hmmm.

after passing him that ( a weingart is to pull the wire out ) *tsk tsk*,

dr. lee: " rm5 one hour right?"

jess: "rm6 per hour can ar?"

[i noe money minded. but WHAT. he's a dentist. so what. sap sap sui laa. hehe]

dr. lee: " hmmmm. okay laa. go count how many hours u had worked."

yeappyyy! omg my mouse just dropped to the floor. *picking it up* ok back to blogging.
i had worked for 54 h and 10 mins. screw the 10 minutes. lmao.
thats like...

2 and a half dayss.

uhuh, cool herr? :D

after

1/ learning all those tools names [i kept forgetting... but the doc and nurses are kind],
2/ washing tools,
3/ helping out with the records stuff [ of course i didnt play pinball ]
4/ had fun with a DLSR teehee. keep taking pics of people's teeth.
5/ bringing tools for doc and nurses,
deamon plier kutu mosquito forceps weingart niti ss handpiece probe mirror... etc
[ hahahaha. not THAT bad. i can rmb some. but theres still alot... oh well]
burning the composite for brekets are FUN. just hope i dun burn down the whole building.

6/ slacking around, watching tv [lol. i cant control my eyes. they kept looking at the tv. i tried.], today hbo was playing some weird dracula movie. starring brad pitt. so boring showw. LOL. of course i didnt WATCH laa. u tink what.

OH YA, watch mou gket han todayyy peeps! it rockss.

ch 311, 7.00-8.00pm. (:

weeeheee. gaji sampaiiii. @#&^#%#^%^$%&*^#&%^$%#%^$%&#
yay meeee.

so according to the kh we learnt, hehehee.
gaji= masa x rm bagi sejam
= 54 x 6
= 324

i go home to eat my lunch everday i work. LOL. sleep awhile oso lorr. oh ya, i have a debit card noww. still not sure how to use it. hehe.

right after i got the pay, i bought a dress. i was thirsting it for so long. haha. and its quite cheap. :D i actually used my own money to buy it. this never had happen to me. wooohooo.

awww man. its raining mole and guinea pigs.
haha. g- string. jess is not sickkk. duhhh. cant u see the innocent look? (;

jess signed offf. (x

OU outing

2009-10-17T13:20:00.005+08:00

went to ou with frens. (: no more ou for the week man. sick of it liaooo. nex week we go again! hehe. my msn come on! ):

outfit of the dayyy. pic taken by my mummy. (: i rly do look like her when she's young. hehe.

we met up at mcd. as usual. (: i walked from the front part to mcd. lol. a bit tired haha. and and... alex didnt go that dayy. cos she went to ou for 3 times that week. so.... ): we ate at zanmai.
we were thinking so long what to eat man. i think we pissed off the waiter. 2 waiters to be particularrr. hehe. nyehhh... expensive. nyeehhh i think i dun like this and that.
at last, duhhhh. we made decision.

xinying wore the ah gogo hair band hehe. do we look lesbo? LOL. people always say that. we always sit close together. so? haha. sit so far for what? LOL. not like xy is smelly? haha. we are totally straight. LOL.

shushu jieru xueer (very hard to take her pic man) pictophobia haha. ANLIE (:

we went to u-bowl too. i'm damn jakun. suck in bowlinggg. then there was a pro dao bowler beside us. haha. malu sia. HAHA. shu and xy strike... and and and... i lost 3 marks to xy hehe. so yeahh. i'm last. anlie and xueer *cough husband and wife cough* went to "pak tohh" hehe. find job too. they found some sell bottle job. hottle? hoattle? LOL. forgotten the name. hehe. chai yee vonne's name was the first one. then xueer and anlie told us about the job, xy and i put our names there too. mostly likely we're not gonna get the job. cos they want 18++. i look 18 ryte? (: haha. btwww, 80 bucks just PUFFF! goneee. awwww man.

seee how jakun am i. LOL. the ball sure go in longkang. haha. wait this reminds me of shao qi. HAHA.

xy damn pro at the last round. STRIKE! and this green ball looks like a watermelon. xiguaaa.

jess jieru

and of course we went to the arcade. arcade will certainly empty your wallet/purse/ pocket wtv. it makes it lighter. haha. someone told me that. hmmmm. the arcade there ryte, damn sunyi. 1st time man. dunno what happen to ou. like became less people. oh well. we stimulate the economyyy. haha. btwww, do u noe that teachers called each others with an "ah" at the front of their names? like ah ng, ah loh, ah tehh. LOL. AH CHAN. heyy, anyone added pn chan's fb? LOL. i did i did! hehe. both pn tan too. (:

xy can kungfu dung. i mean DUNK! (:

hahahaa. i love this game the most. i play this game every arcade i go. its some japanese hitting-drum-game. when its red, hit the center part. when its blue, hit the side of the drum.
and and and! sometimes need to hit alot of times in one shot. WEEEHEEEE! i wanna play againn.

oh yeah, this time vic ethan robyn ashmen were playing pool downstairs. saw them (:

after play until pokai, we yum char-ed at wong kok. chat chat chat... SEE? i took xueer's pic. as in her FACE... i'm proud of myself. tsk tsk. awww man, nowww ch 301 is playing beach ball babes. nvm i watched them during the weekdays liao.

*awkward moment*

Happy halloween peeps! any party people?

jess signed off.

@ school and my house

2009-10-16T10:40:00.008+08:00

" @#$%&$^#$... OMG!"
PMR PMR PMRPMR is overrr.

OVER u hear me.

OVERRRRRRRR...

some of them say darurat kurung di rumah sudah tamat. so sejarah man.

my table is so clean, x messy and definately no sejarah kh geo sc textbooks/reference bks.

snapshot #1 (b4):

and there's those... jessica u can do it!

8A's stuff. and DO WORK.

sheets of papers sticking on the wall.

with blue tapeee.

snapshot #2 (after):

when i was taking the books away from table, i was like

"suckersss, get out! sucker sucker sucker." haha. while throwing the books to the floor.

no more books now. i tink i'll rarely use that table too.

^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^

a day right after pmr, we are such good students *cough teacher's pet wannabe cough*

we helped pn ching for the spbt thingi. hmmm... i tink i didnt help much.

alex got her specs! the pink one is hers.

alex with xy's specs and xy with alex's specs. taadaaa!

alex and i choped. not karate chop as in cap mohor cop. we got bored of choping and xy, jieru was busy wrinting the number... etc.

so WE wasted ink and chop chop chop chop! haha.

shu and adrie joined the fun. yeah i noe we are lifeless fellass.

wachaaa. gogo power rangers!
the books at the back are damn shit DUSTY.

adrie came too. he said he was bored at home.
i felt that i did nothing. i was totally kacauing HAHA.
awww man. at least i woke up and went there...

thats our new english literature book next yr.

and and and. they change meniti kaca man.

no more gila mahyun for the f1. LOL. they change it to some shoe story.

^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^

after messing around the spbt lab [maybe its just me] oh well, my mom fetch us to my house.

btw i'm eating grapes while blogging. and i just choked.

we watched THE PROPOSAL at my room. and they keep changing places.

as in alex sit at xy's place, shu sat on my place.... kept changing.

i noe i noe. the room is SMALL. haha.

movie rating: ***

not bad laa. especially the chanting part. HAHAHAHAHAHA. go watch it! (:

and i watched ily, betty cooper. omg what a movie. i dun like it. weird movie.

for some reason, there was a gal tot condom was balloon and blew it. nyehhh. i think u dun wanna noe more. movie rating: * and a half star.

GUESS WHAT? i finished twilight. finally man. the book was there since last yr. and shu missed the book. haha. i watched the movie b4 the book. so... erm i love both laa. (:

shu lx xy jess

xy jess.

xy gonna remove her braces soon. soon enough. :D

lx xy

shu jess

shu xy lx jieru

main badminton juga. tapi half an hour je. haha.

lx was suppose to be a mickey mouse. i mean miny mouse.

btw, do mouse like toufu??

jieru too pro de. haha. she one man showw.

no one woman show.

lx went home early. then we went upstairs to play metal slug. i keep dyingg. haha.

jieru locked me outside the house LOL. by accident. i was bringing xy down to her mom and i forgot to bring keyss. aww man. dumbo.

and my mom went to fetch my brother and shun bian sent shu home too. anyway, i went my neigbour's house to play play. haha. play with the tortoise. i bathed it. hehe.

hmmmm. i feel like sleeping haha. i'll blog about ytd tmr. haha.

i hope i'll get the 80 bucks aww man. but i tink i did badly. aiks. jess, u can do it! weeeeeee.

jess signed off.

Happy Raya!

2009-09-20T22:36:00.004+08:00

Yay its hari raya. although i dun puasa,
although i'm not a malay,
but still YAY. haha. cos there's HOLIDAY! haha.

Happy raya. maaf zahir dan batin. (: those foodsss. beef rendangg, ketupat...

pmr lalalalala. less than 2 weeksss.
@##%$!#$#$#@!$##$@##$@$whoasofreakingggggfast@#^%^%^$%$%!!!!!!!
everyone studying ehh??

PLOCK is so funnnn (: but anyway i suck in it. again. like waka waka. whoa. i shud playy wakaka.
so longg didnt playy. haha.

watch it. megan fox is so sexayyy. (:
even when she says the ef' word. Be yourself!

jess signed off. boo. i want that ice-cream. gimme that, ronald!

i may be suffering insomnia.

2009-09-05T21:09:00.004+08:00

Hey lo, peeps! i didnt updated since 800 years ago i tell you. okay maybe not THAT long. but its at least 1 month++ i didnt blogged. haha. my blog is so died. is like coming cross a dead town. got flies and wind. haha. did u all miss me? haha. dun lie i know u do. :)

currently love drunk- boys likes girls
is stuck in my head. haha. i desperately need the song in my phone. :)
hey hey hey hey! Hot sweat and blurry eyes.
i used to be love drunk. but now i'm hungover. nanananananana~ haha

my daddy is coming back! didnt see him since june. after he caught in the accident. :( miss him.

haha. i guess u do not know whats sm eh?? sm stands for soulmate.
haha. my soulmate is james chong. naik pangkat de. let me see. he can read my mind, we can even listen to the same song without pakating. or name the song. but rarely. haha. he's awesome. we're just soulmates. thats all. haha.

waka waka, i love it!!!!! haha. its a cute pac man game in fb. muka buku. haha. but i know i suck in it. haha. i'm only like in lvl 4. haha. not like that crazy just cutted hair william, haha. lvl 11!
envynya. james oso not bad lvl 5 haha.

have you ever come across some dumb translator? haha. heres one.

malay: kamu sangat hodoh.
eng: u hodoh.
== they didnt even translate the ugly. hmmmmph. i'm hungry again

oh ya trials! holidays was full of shoppings. pavilion mid valley ou brem mall curve ikano ikea u name it. totally forgot about swine flu. hope i dun get sick. hehe. i started studying on thurs. so yeah i can do it!!! *grins* weeheee!
jess is ks in a way. haha. ikea's ice cream is back! haha. that rm1 ice cream. haha. cheap and nice.

hey guys. try to do the trials paper 09 in this website. they are quite difficult.
but at least u tried and geddit. =) www.koleksisoalan.blogspot.com

celcom sucks laa. i hate it so much. painful for those people from maxis. Sorry people. haha.

i cant sleep for this few days. my eyes are still widely open although its 2 am. siao i dun feel tired.
maybe i'm worry about trials. or something else. i oso not sure. insomnia.
whats the side effect of have not enuf sleep? haha. PIMPLES.
big huge enormous ones. lol they pop pop pop. whether u like or not. they are mean. haha.

can anyone explain whats narcism?? haha.

boys likes girls- <3 drunk

jess signed off. ciaoz.

BSMM Installation 09-Drama Night.

2009-08-02T10:10:00.011+08:00

jess now then upload the pics. haha.
last sat(25/7/09) was drama night. we had fun!

alex jess

Theme: Hall of Drama

Venue: WIM building.

B.O.D 08/09

we will definately miss u guys. u guys rocks!

chip jielin jun herng kah yung anthony wei ting sabreena Mark Chua

hongling jess xy alex

hongling jess

xinjing jess alex

alex xy jess jiamin

alex kyexien denise jess xy

denise jess

jess xinying

HAHA. no life.

xy jess shuyan

we are like strangling shuyan. ==

alex xy shuyan jess

alex xy jess

jess xy alex 's

haha. i dunno how to walk with heels.

i will be walking with a duck! =)

sharmaine jess

she say she suppose to be hannah montana. err... okayy. haha.

but damn lenglui anyway.

alex kyexien jess

he is a nerd in a sketch.

alge

BBBBRRRRRAAAAAA! haha.

david jess christine alex shuyan

helen jess.

haha. james, ur neigbour

jess alex

shuying jess

u look hot that day. :)

hongling jess xy

xinjing jess kyexien alex

jinzhi joanne helen wenyee david

xy anisa jess alex

ANISA!! =)

alex jess wun sheng xy xinjing

jess wun sheng xy

xy jess siaokarmen

xinyee xy jess alex shuyan

xy jess jenwei

jess shaoqi xy

:)

xy jess joee.

lenglui leh ^^

the gals. haha.

jess shuyan mervin xy

jess markchuachunming

xy jess chip

alex xy jess weiting jielin

jess engjunherng

do u like the card we made u? =)

its hard work leh.

melody jess xy

jess marcus xy

marcus ar, is damn shit HOT! haha.

even he can walk with high heels. HAHA.

shinyen xy jess

xy jess

shar christine xy anisa jess

jess alex david

xy and her broom

wailoon jess

we took this in front of the toilet! haha.

feel free to grab yr pics. =)

omj i'm finally done.

jess signed off. :)

happy belated bday shu, my best best fren! =)

2009-07-30T19:08:00.003+08:00

was browsing thru xy's camera. i found this. this was f1 haha. 1 Cempaka.

jess malcolm william haikal anjelee yee vonne. u poser =P

haha. today we had some surprise party for shu. and she didnt suspect anything. LOL. dats cool.
kk. last night, william colled.
eh wanna celebrate shuyan's bday? haha. OKAY =P he got some 50%off Br coupon.
kayy. then i told shu that there's gonna be a farewell party for the B.O.Ds haha.
what a lie. =P then ask her to go.
LOL LOL. then she skipped her tuition.

she was always saying she don't wana go. haha. OH SHIT. haha. LOL. now u see how i feel ryte shu. haha. happy hor, shu?? haha. have such good frens... *perasan sia*
why did the money come from? $$
from jieru LOL. 50rm. still got 10 bucks kayy. we very 'han'. haha.
tanpa wang itu, no money no celebrate. haha.

xinying shuyan
shuyan jess
HAHAHA. retarded alex jess face. =P

william's eyebrow jess. next time i'm gonna pay bck.
xinying alex jess james +candid.

kayy. shuyan. thanks for being such a good kind nice lovely chubby cute...err...

*crack head* beautiful hot pretty lenglui artistic fren! haha. CHUA SHUYAN.

get to know her. u will love her kao kao. =)

alex----> T.T dun be sad. i got ur back. do more maths quos. sure can de.

haha. xinying ar. u so MAN! haha ^^ camera no battery liao.

fine. james and i created a cool game! its col the saying-out-mjsongs-at-the-same-time-game haha. so long. try it. LOL. and he ate the ice cream toast that no one wants to eat. cos it was melting. haha. destiny james. u and food. == lattalilattalitampom! LOL. we are some lifeless fellas.

haha. william. thanks alot for scarying me. SPIDER THERE! ==

update about installation will come soon. wait laa. =) got all the pics now.

jess signed off.

whats done is done.

2009-07-20T21:57:00.002+08:00

Yeah. i lost. haha.
i wun be sad. =P
lost kao kao laa. that hsl
mark chua chun-ming ar
PRO DAO!!!! haha. and he dedicated the song to some pretty young lady.
haha. everyone sure noe who. XP he won 1st btw.

james and i kena owned. haha. and the shi sua sua won 3rd!!! haha
@#$%^%^&%% i didnt get to watch.

what a day. we got ntg but memories. haha. i'm damn optimistic ryte?
yay! haha

i had fun.

thanks for william chu hsien li for skipping bc class to support us! haha
he is not going on tues too. some prs thingi. good luck u and pn chong.

weehee! XD go do homework laa people!
now i noe that tsk i not tak sakai or something.
is a sound effect! HAHA.
and yes thanks woon peh yee. fo typing the bc hingi for mee. i will make it up to u. haha
but not $$ haha.

HAIZZ. installation is coming.
OH NO EXAMS!

jess signed off. YAY!

haha. =D damn happy.

2009-07-02T17:37:00.003+08:00

haha. happy bday anlie lim!
anlie lim ( ) ( ). no then i noe i dunno yr full name.
haha. even mr yuan dun noe.
okayy.

omg. i'm asl! i mean probation.
haha omj omj omj! u did it? wow. cool. haha
thanks to the bods. thanks for choosing me.
one day i will tell you all. this will be the right choice!

and once more time... william and jess is not coupling.
we are just damn damn damn best frens
haha. =D
i like him? my taste not that bad okay.
haha. kecoh laa.

OMJJJJJJJJJJJJ
freaking happy.
thanks james.
james chong.
haha i hope we dun screw up.

i'm hungry. LOL ^^
maybe i shud try having
the deworm medicine.

alex is back! yay.

new lcd. i'm freaking not use to it.
the screen
damn big... ==

i stepped on a cicak
a cicak!!!!!!!!!!!!!!
in my room
i thik i need to tidy the room. haha. u dun wanna noe how messy. =)

hahaha
and guess what
cindy and vi vian almost got screwed

jess: who i pn loh again?
vi vian: (haha i forgot what u say).... then stupid woman.
cindy: she got issues.
then pn loh passed by.
....
.......

signed off.

Thanks for everything guys.

2009-06-23T20:01:00.004+08:00

yay! weehee~
i finally got my name tag! first BSMM name tag.
haha. i feel honoured. yay. so happy lols.
haha. my bday was on june 9th. if u dont noe. or dun care.
watch out if u didnt greet or lagi geng didnt buy me present. =P
jk la.

the J is from anjelee. its made of opal. rmb sc opal? haha. jess, ure such a nerd. i love it.
btw dd u watch obsessed yet? its sick. haha. but storyline wow. cool.

and haha. the double heart thingi is not a curse. how did u actually access to my class??
wait to my calculator. ure weird. i dont even noe who u are. but thanks for it.
it's damn nice! XD

a cup from william. a cup! the football on top can spin de. thanks buddy. we shudnt ponteng too much. lols. and i'm damn lenglui ryte. haha.
crowd: "ryte..."
swt. teach me maths.

earrings the most. damn nice too... haa. group present photo. i didnt get to celebrate. oh well. =)

the purple crsytal like thingi and earrings from wanteng. sry didnt get to buy for u, kh buddy. haha. soli.

the blue-ish earring and necklace from shuyan. she reopen/re-notdelete her blog. haha. yay!

the photo frame from xy.

the hp holder from james. haha. its cheap. i mean not expensive ==. but i like it. haha. its so pokadotted. how do u even spell it?
3 earrings and a tiny card frm my bet fren, alex! haha. and yes she didnt greet me dat da. hrm... alex. but yr te first one who gave me the presents. ok laa. ure forgive. LOLS.

haha. dun forget the cup. from william. =)

er... and thanks for everything people. thanks for being beside me when i'm sad. cry. or even happy moments.

thanks for telling me jokes! haha. especially sick ones. one.

haha. i got one.

what is the similarity between an underwear and a hotel?

they both have ballroom!

geddit?? no? er. nvm. but still laf. LAF! haha

thanks for calming me down. haha.

thanks for smsing. lols. and....

i lovee u all. u all rock! rock on. haha. be my fren. u wun regret! ryte...

my daddy is in sg now. missing you, dad. haha. hope u get well soon. and happy father's day!

sometimes being retardd is fun! haha. even ronalds teeth are bigger than mine.

but i tell you. he have a lot of cavities. nvr ask him to open his mouth.

if ure emo now, smile. dun be so kedekut. no need give money oso when u smile.

=) =) =) (= (= (= SMILE. tmr is a brand new day! and we're getting older.

aren't xy just beautiful? haha. YES! aw. she doesnt has a post. =(

i slept the whole afternoon. sooner or ltr goona be a pig. haha. oh no, swine flu.

H1N1, confirm no fun!

jess signed off. go fb lols.

I am Jessica

2009-06-18T19:41:00.002+08:00

Since she haven been updating , I shall update for her.
I'm such a kind soul right?
yeah!! =DD

Alright..Before she finds out that I've been going into her account , I will tell you a joke!!
A joke told by Ailing. xDD

How do you irritate Lady Gaga?
Answer: Poke-her face!!!

AJHAHAHAH..
Wakakakakaka..
Hrmm...
Singing competition at 6/7/2009.

=DDD

This is so random. Wth.. xD
Jessica had been bringing guns to school!!
Crowd - HUH!!! OMG...

Yes , Jessica brought guns to school!!
She is a bad girl.

Nahh.. Just jk. xD
She brought it for komsas.
=D

Hrmm...Wtheck..Okay..Bye xD

Forgive my randomness,
James Chong

7A 1B

2009-06-18T18:59:00.002+08:00

i got a B for bm.
a B! haha. B for bad.
no wait. B for Best!
haha. and my purata is 88.9.
i didnt get an 8 b4. since f1.
yor. nvm theres trials ryte...
no need to be too kiasu.
haizz. but but... aiks.

happy bday, wong wan teng!
dun ponteng too much ya.
and i'm starting to ponteng now.
owh. not ponteng. 'helping teacher'
today the pejabat was so wow. many students asking marks.
where is this teacher. where is that.
haha. geng.

watch the jo ee's pm punya vid, its damn nice.
like another henry chow.
its about h1n1.
watch mar yiyuan's singing on youtube.com
http://www.youtube.com/watch?v=mUGeO0hCGv4
go see! haha. our shouting like cover yr voice, yiyuan.
but still love ur voice. =P

i read abit pastel james.
omg. so sick the front part.
omg. first time. shit. nvm.
but funny. LOLS!

ok bye. tmr is blood drive people!
donate blood is cool
is fun. not pain one. XD

2009-06-10T22:23:00.002+08:00

haha. dunno what to put for title. so its
blank.

BLANK.

today, the plumbers came. they kao tiem the paips
haha. one of them say hes a hero!
yeap =D i think they are.

we are such despo people.

my mom didnt slept for two night. cos need to stay up to look after the paip.
scared they will burst!

BURST. splash. haha.

bad experience man.
omg water.
we cant live without water.
even u shit u also need to think.
haha.and i think i'm pro in paips now. haha. but not parit laa. XD

my dad is fine. just done his the other leg's punya operation. 3 months++ cant walk.

3 months leh

but hes coming back home on sat. or sun.
wait. how is he gonna shit or pee?
he is actually kinda temporally handicaped.
err. seriously. anyone knowssss?
there shud be an easier way to do it ryte?

the van driver that langgar my father. haha. watch out! lols
yes he went to lapor to the polis
but it happened after he drove off 4 15 mins.
how the flower do we know that is he the right driver???
they may change people. cos the guy dun have license or something. or even worst that hes drunk driving. hrm who noes. haha.

awwww. the uncle that stay in the same ward as my daddy has cancer.

brain cancer.

but he is optimis about life. he looks so happy. haha. and tell us his old stories.
hes dropping hair. and no appetite.

and another one in the other ward, langgar by car oso. half of his body paralyzed.
PARALYZED. cant move. but the families are very supportive. take turn taking of him.
he has a lot of grandchildren. hes a malay uncle.

my dads life was seriously saved by god! a van crashed on u and u didnt die?
miracle ryte. god dun wanna bring daddy away yet. god, thanks for listening to our prayers.

LOVE YOU, GOD!

haha.

haha. about me. my bday.
this yrs bday is so sad. and weird.
i celebrated with my dad. in the hosp.
with ta bao food. japanese food.
haha. sushi XD and thers a surprise cake.
my parents did all this although dad was injured. and mums so tired taking care of daddy.

thanks dad. and no need to be sorry.
u cant plan a party for me, its okay.
u cant afford to let me spend, its ok. haha. i wun go shopping too often dad.
promise.
my bday wish is i want u to be safe with us. with me, mummy and ronald.
be healthy. and blessed by god!

haha. i cried. dad's words are too touching.
even when i blog, i cry.
smile jess smile =)

btw, u can actualy blog with emoticons? cool.
haha. teeach me.

thanks for everthing god. i noe YOU love us. and we love you too.

my dad's alive

2009-06-07T21:12:00.002+08:00

ok let me do something 1st.
xinyingxinyingxinying,
HAPPY BELATED BDAY!
sry for haha. thx mr. teh! lols.

ok back. my dad was unfortunately caught in an accident near tmn tun. 4/6/2009
he was drunk and he didnt drive. he was walking bck home.
he didnt use the jejantas. a van curshed on him. and he flyed.
watch pecah and the time stopped at 11.10pm.
it was a Rolex! haha. omg ryte.

someone called my mum with my dad's num.
its so scary.
"hi. steven here is with me. no he is gonna be sent to UH. pls... blah blah"
panic man. ronald and me. stayed at home. and prying hardly. that daddys gonna be safe!

his both leg almost patah. bone and joints crack. HE'S ALIVE. thank god.
my mummy is taking care of him in the hosp now.
he will be fine ryte? haha. cheer me up people! XD. tell me a joke. haha.

and yesterday 6/6/2009, my house punya paip pecah. BAO! lols.
wth ryte. dad like dat and now. outside punya main paip bao lor.
and my parents are not home. they're in the hosp. we are alone. haha
panic. what a week. tears drop...
bad luck laa. pray for me!

i need to say this...
GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
hope all this can... u noe. change. turn better. i am really afraid my mom cant take it.
anyway....
god, i am really thankful that my dads alive. i love u god! love u.

thanks for cheering me up guys.
smile :)
jess, smile. we mus stay strong. haha. buff!

stay strong jess.

bye.

alex sudden visit.

2009-06-03T20:57:00.002+08:00

haha. xy told me how big and how nice was malcolm's house. haha.
whoa. impressed haha. COOL! a house with a waterfall in it? omg. yeng.
and it looked western and chinese in the same time. haha. nice XD
hrm alex came to my house after meeting up at mcd with kb, james, denise, jo ee, kah meng, pei wen and xy.
haha. whoa poking french fries into ice cream! lol. and james chong, omg ur joke damn sick! ur fren's joke. sick.

we watch x men wolverine. omg i'm not sure whether is the dvd sucky or the movie just suck kao kao. when they fly, got rope tying on their back! and suddenly the image willl turn into comp graphics. like grey in colour. and the storyline haha. funny cos its dumb. and why at first the name was james and at the end become jimmy? dats weird. my brother always kacau alex. and look what happen to alex.
... ... ... ... ... ... ... ...
... ... ... ... ... ...

ronald pushed her down to the floor. ==. irritating brother. alex, agree?

the movie is so so so sick. i think ur pervert alex. haha. when wolverine is bein experimented, he was naked. and the JUMP out from the lab. JUMP TO the waterfall. but we saw ntg. ryte alex.

haha. the hand thingi suppose to say x men 3. hahahaha. nvm.

alex is a chindian if u havent notice. haha. thanks 4 the present alex! i lovee it. haha.

should i celebrate? haha.

congrats vincent! XD

2009-06-02T15:25:00.002+08:00

introducing...

The3Senzations

my cousin, vincent ong made us proud again! haha.
the customes look cool hor. haha. they are designed/sewed by my aunty. his mom.
they played the song called Shine Down.
and they are coming to KL for the competition!
rock on, vincent! haha
what a short post.
bye. off to play badminton again!

check it out! XD

2009-06-01T22:20:00.002+08:00

hahahaa.
go see http://howgayisthestory.blogspot.com/
haha. thats peh yee's blog. but its all about jekyll and hyde.
remix version. haha. go see. damn gay. lmao!
ok bye. i'm so hyper today. haha...

hope SS20 win! XD

2009-05-31T21:07:00.002+08:00

haha. today was quite fun lol.
there was some judges came to see how well is SS20 doing.
how good the neighbours are. and all.
there's a contest. which is the best tmn? haha.
hope SS20 win. i cant say we. lols. i technically dun stay in the tmn.
but now i kononnya stay beside hannah. KONON. haha

went DK quite early. haha. about 9.00 am.
hrm i noe that f4 guy study in smkdu but dunno he's name. er. nvm he went too.
got free nasi lemak! haha. it was ok. nice.
my brother drag me in to the cheer team. ==.
haha. hannah was in too. her mum is so humourous.
we are big children! LOLS.
actually our work is damn easy. just say the word 'u' and whistel. haha.
but it's not easy at all. tiring laa. it starts at 9. and the judges came at 10.30. hrm.
the small and cute children (exclude ronald in the cute part) say
SS20 welcome
then we say YOU! haha

SS20 welcome you!

lame. and sort of embarassing. haha. and need to run here and there cos not sure which gate the judges will come from? the left or right one? LOLS.
we welcomed the wrong people. hrm haha. and greeted the correct one at last.
man i hope they dun post it on star! or TV3. but most probably they are. so everyone. dun buy star and dun watch tv3 today or tmr. swt. jk laa.

but atleast we got a free bottle. plus ronald's one. 1+1=2! 2 bottles haha.
i kept getting free stuff lately. haha. yay.
vic went too. LOLS. yet i think she went to get the free food nia. hrm. she came quite late.
there were horses! haha. the horses abit weird. lat mou de. hair can erm drop. haha.
police on horses quite yeng hor. haha.
and i met a dog col sam. haha. he always fight with hannah's dog. haha.

haha. james. one day u will ryte? haha. curious. =P

being childish is FUN! ryte...
fun. haha. i ate ikea hotdog for dinner. and 3 cups of soft drink. LOL.
now abit hungry lols. i'm getting fat. shit. haha.

holiday makes people fat.

theres some bird park exhibition in ikano. the peacock made me shocked. haha. it was outside the cage. and theres some cute chicks. i mean chicken chic not chick. not gals. nvm. haha.

watched into the blues 2 today. man so sick. gosh i closed my eyes with a pillow all most the whole movie. technically i didnt watch it properly. dun watch haha. but the guys are hot. lols.
biceps. haha. watched wolverine too. got rope tying their backs when they fly! hrm. so weird.
and i thought xy's dvd was weird. mines too.

i'm thinking... thinking. yeah i'm thinking... still thinking. haha! go watch night at museum people. haha.

bye. childish day.

100

2009-05-30T21:56:00.002+08:00

1...
2...
99...
100!!!
yay the 100th post. haha. finally.

erm today was quite fun.
morning went for bomba trip.
haha. i suck in putting ou fires. hrm. but i did it!
haha. omg. christine lim is sooooo sick.
u sicko! ure making my mind sick.
oh ya, the kh question, the one what can extinguish peralatan elektrik ryte.
haha. shu asked en shaari. the pegawai 0. swt.
erm he say both can use. haha. arguedable quo then! haha.
karmen: u anak handsome tak?
en shaari: anak perempuan la. lawa la.
karmen: i fikir anak kau handsome macam encik!
lalala. haha.
free 100 plus! haha. but u need to ans quos.
how old are you? 14! thats how i got mine.
oh ya

today i blogged the 100th post, and i got a free 100 plus!!

after that, i watched push at one of my old frens house. huge house haha.
go there for fun! XD.
PUSH! haha. not bad laa.
there's like some people having special powers
eg. u can change people's mind by looking in their eye.
whoa i wanna have this power leh. can use it to buy something.
look into the cashier's eyes and show him the image that i have paid.
then i jus walk out from the shop. whoa. in my dreams laa. haha.

i saw aravind in tropicana city. not sure about the spelling.
aravind or aravine? erm dunoo.

prefects really berdedikasi! haha. noone should kena scet.
i jus read james' blog. haha. i'm gonna be 15! haha. soon. buy me presents ya! XD

bye.

happy teachers day and erm nice movie!

2009-05-29T20:09:00.004+08:00

Happy teachers day! XD.
Performance were awesome. not regreted going haha. domino coupons.
the people who didnt go. u missed them! XD too bad
i think there will be videos in youtube. haha.
hahah. rui min's bro. nice dancing laa.
and the asduta. woohoo!
james and mark production. hrm. just a word. dramatic.
sit until my butt pain! haha. numb.

night at the museum 2 is freaking nice. battle of the smithsonian.
funny meaningful and still funny.
the cupids damn cuteeee. haha. they sing.

monkey slap! slap u slap me.
abraham lincoln oso got. haha.
then got some gangster tai lou. black and white de.
they can even go into pictures. haha.
and pour water out from the pics. hrm.
got guy statue kao lui too. haha. show biceps. haha.
this movie is full of ideas and thoughts.
creative leh. haha.

we saw so many du-rians today in ou.
omg damn alot
form 2s la. shao qi laa erm jin zhi they all. one gang one gang de.
jo ee haha. aw mcd again.
vivian sophie grace christine melissa peiyi
poo choo they all and the form 2s watch the same movie.
same time. haha. oh ya melissa april they all oso.
in the cinema, mostly smkdu students. haha. front and back.
serious. then go out. see pn tan. the malay teacher.

ate mcd. rm5.95. LOL. if not? cheap and nice.
someone took our pic for their projects.
kononnya laa. i hope we can have this type ofhaha. xinying and james, i bought ur presents. haha.
LOL. hope u all like it, best frens.

i noe more about angles and demon liao. haha. alex explain some to me.
in mph lol. it rocks man. haha. dan brown rocks.
today was a tiring and fun day.
ok bomba trip tmr. wake up early.
omg what time? haha.

bye. nice. 29/9/09.
most smkdu-rians in ou. cool. and we were there too.

sry laa

2009-05-28T19:05:00.002+08:00

i'm sad
not because of u. high mark. or wtv.
not kiasu.

its just bcos.
i didnt did well.
dissapoint my mom and dad.
and dissapoint myself.

i cry cos i cant take it. 27 is so unlucky.
fine this post is so emo haha

laugh more jess.
hahahahahahahahahaha.

Happy Bday, Anjelee!!!

although she dont read blogs haha.

i hope i can be happier.
aiks. oh, i watch hannah montana today
haha. omg damn nice XD.
but i think guys watch sure say weird.
but its freaking nice. funny and the romance was woohoo.
haha
nice laa. good storyline and all.
i dun really like miley but still.
NICE.

night in the museum.
i watched the trailer.
looks funny. my com is soooooo laggg.
but can blog.
facebk cant even sign in.
haha. blurcase in facebk.

hrm vietnamese guy. andrew. LOL
i thought u were white. no black. nvm haha.
he is funny and weird
its 9.19pm in aus now.
erm 2 hours diff.
lc i miss you lol.
黄梨高佬！ haha. those days.
Li Ching.

ok ciaozz.

Last Lust Laugh

2009-05-27T15:09:00.002+08:00

exam is finally over.
yeah.yeah.yeah.
over...
i cried over a math exam paper.
=( u wun noe how i feel.
nvm who cares.
wee~~

eric did something "great".
he wrote

12-1

Last Day!

on the board.

" whoa. eric so clever. he noes how to write an !"
swt. so sarcastic.

then isaac erase the last and change it to lust.
What is lust?
sound like something bad.
haha. everyone was lafing.
hrm asked malcolm and he said its
" having sex for fun."
haha. then i laff.
swt i'm a christian and i dunno.

anyway, i wiki it.

LUST.

"Lust (or lechery) is an inordinate craving for sexual intercourse often to the point of assuming a self-indulgent, and sometimes violent character. "

hrm. lust is a sin. so dun do it.
yer. it sounds sick.
i'm innocent haha.

i saw so many people wearing school uniform today in ou. hrm.
off to do sejarah project! no... com so fking lag.
freaking.

an update =D

2009-05-26T14:39:00.003+08:00

one more freaking day!!!

omg omg omg.

exam is so sucky.

suck. suck suck. haha.

zaiton glaze is evil lol. scary leh.

oh no, stupid perkembangan.

i hope pn zaiton.

can u noe.

erm. simpati akan nasib kami. lols.

is LOL with s cooler?

LOL or LOLS is cooler. swt.

hahahaha. sejarah project=gg.

gonna start soon.

soon enuf.

ok maybe ltr.

i havent blog for 1 month.

1 month!

tmr maths, bm and pjk.

pjk lols.

so long didnt pjk.

i didnt go schol twice on tues. pjk day. LOL

haha. cuti study lol

MY COM IS SO LAGGGGGG!

msn dc dc and dc. gg de laa.

it seriously needs an upgrate.

ok bye. sejarah project time.

wee~~

an update.

Wish me luck :) i'm ready to serve my best.

2009-05-04T18:55:00.003+08:00

haha. interview tmr.
scared. fear. i can do it ryte?
erm. wish me luck.

JESSICA, u can do it! [i'm cheering for myself]

whoa. tmr need to bring pj clothes+2 badminton racquet+bsmm uniform
see-pay geng. haha. luckily bag not heavy tmr.
not like today
SO FREAKING HEAVY!!!! Lol
haha. and
why must change time table for 6 times?
SIX TIMES!!!!

haha
cut down so many trees indirectly.
haizz. global warming cos by this people.

i have new speakers haha.
i love it...
better than dun have
use webcam and chat.
wei, i cant hear u!
now haha satisfy.
LOL

any nice english duet song? tell me in the chat box.
not so hard to sing de. haha

hahahahhahahaahahhahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahaahhahahahahahahahahahahahahahahhahahaahahahahhhhhhhhahahahahahahahahahahahahahahahahahhhahahhhahahahahahahahahahahahahahaha

i'm doing this to release my stress

lol. interview is not scary, show them what u got. I am prepared to serve my best.
that whats i been telling myself. ==

chance has come. i will catch it and wont let in go.
i will pray hard.

Oh my lord,
give me wisdom and a cleared-mind for tmr's interview.
i deserve a chance and the chance has come.
give me the intelligent to show them i am capable to serve.
thanks lord for listening to my pray. i pray in the jesus's name.
AMEN!

bye! ar. i feel calm.

TAgg. Tagg. TAG

2009-05-03T14:59:00.002+08:00

Rules and regulation of the tag ;
All 21 people must do unless you don't have a blog.Write the names of 16 friends you can think of in your head.And then answer the questions,Say you're guessing if you don't know,but at least guess on all of them.After doing this, tag your 21 "lucky" friends to do the same.

1. alex
2. shuyan
3. malcolm
4. james
5. william
6. jo ee
7. pei wen
8. yiyuan
9. tunjie
10. eric
11. clement. t
12. xinying
13. cindi
14. grace lim
15. liyen
16. megan toh
17. nasyitah
18. yee vonne
19. wan teng
20. sophie
21. kelsey

1. How did you meet 7 (peiwen)?
erm monopoly. and bsmm laa. =)

2. What would you do if you and 15 (liyen) had never met?
omg damn sad lor. loner in tuition.

3. What would you do if 20(sophie) and 1(alex) dated?
tall and short. jk laa XD. les.

4. Have you seen 17(nasyitah) cried?
no. crying is bad.

5. Would 4(james) and 16(megan toh) make a good couple?
hahahahahahaa
do they even noe each other? swt. ==
maybe. LOL. they are both FUNNY.

6. Do you think 11(clement) is attractive?
hahahaha. yeah. theis damn 'handsome'. ahem LOL.

7. What is 2 (shuyan)'s favourite colour?
blue or yellow? i'm not sure. what a fren. or issit orange.

8. When was the last time you talked to 9(tunjie)?
urm. dunno.

9. What language does 8(yiyuan) speaks?
hokkien, english, chinese erm maybe tamil, who noes? swt ==. nandri!

10. Who is 13(cindi) going out with?
erm. dnno. ask her.

11. Would you ever date 17(nasyitah) ?
hhahahaaha. this tag is so les. erm maybe.

12. Where do 18(yee vonne) live?
US. she wish laa. haha. erm big huge banglo i tink.

3. What is the best thing about 4(james)?
he is a joker XD.

14. What would you like to tell 10(eric) right now ?
hrm whos the gal? haha. answer eric!

15. What is the best thing about 20(sophie)?
has a really cool accent! even with the LA...

16.. Have you ever kiss 2(shuyan)?
lol. palm kissing. twice. but i dun want anymore. i feels weird.

17. . What is the best memory you have of 5(william)?
hrm. william chu. erm a lot of weird memories laa. oh ya every mon always eat at hospital. bad feng shui! haha

18. When's the next time you're going to see 4(james)?
tmr laa. monday

19. How is 7(peiwen) different from 6(jo ee)?
tall and taller.

20. Is 2(shuyan) pretty?
yeah. memang de.

21. What was your 1st impression of 15(liyen)?
nice specs. haha. i'm serious.

22. How did you meet 3(malcolm)?
we were in the same class in form 1 till form 3 lorr. Malcolm ian stohard. haha.

23. Is 5(william) your best friend?
yea a best fren that hates buffet! LOL.

24. Do you hate 12(xinying)?
OF COURSE NOT. i love her LOL. we are not les, william.

25. Have you seen 18(yee vonne) in the last month?
yes laa. everyday except saturday and sunday.

26. When was the last time you saw 16(megan toh)?
last monday. tmr seeing her again.

27. Have you been to 5(william)'s house?
No.

28. When's the next time you'll see 10(eric)?
tmr monday laa.

29. Are you close to 11(clement.t)?
not really.

30. Have you been to the movies with 4(james)?
No. haha.

31. Have you gotten in trouble with 8(yiyuan)?
hope not.

32. Would you give 19(wanteng) a hug?
sure why not.

33. When have you lied to 3(malcolm)?
erm. i sangat jujur.

34. Is 11(clement. t) good at socializing?
ya laa.

35. Do you know a secret about 8?
nope.

36. Describe the relationship between 12(xinying) and 18(yee vonne).
both r girls. frens laa.

37. What's the best thing about your friendship with 9(tunjie)?
hrm sweet? i mean sweet. gula

39. Have you ever had a crush on 12(xinying)?
hahahahahahahahahahahahahahahahahahahahaha.
no laa.

40. How long have you known 2(shuyan)?
3 years!!

41.Does 11(clement.t) have any girlfriend / boyfriend?
yeah ailing.

42.Have you ever wanted to punch 1(alex) in the face?never!!
what????!!! haha. no

43. Has 21(kelsey) meet your parents?
nope.

44. How did you meet 11(clement)?
teacher ma. LOL. haizz. why is this tag so much about num. 11 so sien.

45. Did you ever accidentally physically hurt 3(malcolm)?
hahahahahahaha. i think i stepped ur foot b4.

46. Do you live close to 7(peiwen)?
yeah quite close.

47. What is 8(myy)'s favourite food?
erm.french fries? haha.

48. What kind of car does 1(alex) have?
i dun have one. her popo and gonggong got myvy.

49. Have you traveled anywhere with 9(tunjie)?
tunjie? nope.

50. If you give 14(grace lim) a $100 , What would she / he spend it on?
haha. donate to the HELP JESS FUND! she damn kind. haha ok laa swine flu fund.

finally done. hahaha. thx james. for praising and erm chai saya.
LOL.
bye.

Jessica!!

2009-05-02T23:46:00.002+08:00

You wanted me to type out something about you? Sure. (:

Jessica Chan.

Good Points
1) Stress and confused at the moment.
2) A study freak.
3) A PRO singer.
4) A nice friend.
5) Helpful
6) Smart
7) Pretty
8) Current hairstyle : Lala.
9) Optimistic ( I guess)
10) Good at badminton ( for a girl la)

Bad points.
1) Very big mouth.
2) Chuin po alot of things.
3) Uses alot of credit. LOL.
4) Bullies people in badminton.
5) Very Very Very Very Kiasu.

Nice leh. I know I know. I am a very good friend. (:
Now I already thanked you k? Lol..

2009-05-02T12:28:00.002+08:00

View this movie at cultureunplugged.com

this film is a winnig film.

ntroducing Chicken a la Carte

from: Ferdinand Dimadura

i almost vomitted.

many people die in hunger.

so dun waste yr food.

eat all the rice in yr bowl. if not yr husband/wife will have a lot of pimples haha.

swt.==

omg i'm damn confused.

u didnt give urself a chance, dammit! i didnt say i dun like you. ure dumb. LOL.

wth. bye.

kid photos

2009-04-25T22:04:00.002+08:00

can u guess who are them in the pic?

they are... Danny

Adam

i like danny's hair! haha. so cutee ^^

adam look so erm. lc haha.

whoa i just listened to james lee's singing.

ar... haha. nice.

u prefer

danny gokey

or
adam lambert?

danny! haha. adam is gay.

but gay always look good.

i have a fringe.

2009-04-24T20:40:00.004+08:00

swt. i love to kill pictures! haha.

like this one.

william seriously can advertise fo colgate. sensodye. wtv laa. haha

haha. BSMM kaki. i dunno who is whose. mine is the hairy legged one. haha.

shern yang's the shiniest one.

xinying, have fun! haha. think of the good side.

two best pals haha. weird.

NEW HAIR. LOL.

ok maybe i just cutted my fringe.

but it's new. hhaa

i look weird.

constipation.

hyper. profuse sweating.

guess how i got the wind. from the fan duh ==.

tissuespeakerboomboopow

LOL. my hair sudah cut.
yee vonne oso cutted her hair LOLs.
like my hair? =)
haha.

ok. ever see someone cry in a barber shop?
haha. i've seen one today.

after cutting my hair,

i waited for my mom's turn.

haha. there was a 40++ woman came in

obviously to cut her hair. ==

then her maid/mum not sure erm stand beside her.

then the barber accidentally cutted her fringe.
" why u cut my fringe?" with her cute and weird accent.

"sorry sorry i dunno u dun wan me cut the fringe." the english abit cacat de.

haha

then she say again : WHY U CUT MY FRINGE?

i told u not to cut it! now how am i gonna work? no semangat edi."

the mom/maid said why u cut her hair like dat? she already told u! "

then she started cry!

gosh. cry because her hair.

the barber whose cutting my mom' hair, mom and was laffing non-stop.

hahahaha. swt? would u cry because of that? but the guy cut until quite good leh.

and the voice damn annoying.

thet barber damn no face.

NO MUKA! haha. so weird.

my hair is ok ryte? haha.

alex is going p. perhentian next week! haha. absent for 3 days.

and my daddy is coming back from china LOL

with the wolverine movie haha

swt ==. bye.

have fun prefects! haha.

Ravel Tzigane

2009-04-21T18:59:00.003+08:00

omg i tink i'm liking musicians guy.

lol. they are so erm. cool yeng geng. haha. have some talent in them.

he is really good. enjoy.

congrates joshua, sofea, jensen, james and gabriel lol. owh ya, tanu too.

Happy b4 bday, sophie!

2009-04-19T18:54:00.002+08:00

haha. sophie's surprise party was the BOMB.
christine's dad is so funny.
he was like
"happy bday, sophie!"
then sophie give out her innocent/not knowing anything face.
"it's not my birthday."
oh. "sophie's bday is next week laa. its for grace!"
hahahhahahaha.
sophie still blur about everything.
"why is grace ling still not here?" haha.
and we started without her LOL. she's not even coming.

haha. my whole face kena cream icing.
it even went into my nose. ==
thanks to william haha.
worst thing is the hair.
haiz its like GEL. haha.
wash that time then noe.

sophie was touched haha.
she cried.
haha. grace was so exausted.
she planned everything. haha with william, vivian and christine laa.
thanks to them the party was so successful. haha.
yummy food, i tell you.
fun laa.

and i just found out i went ou today i forgot to buy the size3 pen for seni. ==
haizz. tmr gonna buy in ikano. LOL. bye
go do my bc essay.

bball

2009-04-17T21:29:00.003+08:00

haha. see familiar faces?

haha. DU vs sri permata. LOL.

stupid anugerah tmr. bye.

fan liang post de.

so yeng laa. someone. haha.

and LOL.

which spot do u like to KISS? LOL

2009-04-15T18:24:00.002+08:00

tagged by rachel.
she dances. haha. erm her mum makes a lot of delicious cookies. and Food.

1.Besides your lips , where is the favourite spot to get kissed ?
erm. hand LOL. or ass. haha. kissass. ok maybe not.

2. How did you feel when you woke up this morning ?
feel like sleeping again.

3. Who was the last person / people you took a photo with?
my brother LOL.

4. Would you consider yourself spoiled ?
what? of course not.

5. Will you ever donate blood ?
yeah but i'm scared. ==

6. Have you ever had a best friend who was of the opposite sex?
yeah laa.

7. Do you want someone to be dead?
whoa liao. erm. NO. karma.

8. What does your last text message say ?
let me go check LOL.
which phone haha. nvm i say both.
from liyen. she ask me about sas. LOL
another from 22882.
you have successfully redeemed caller ringtone: HOT AND COLD.
haha.

9. What are you thinking right now?
erm lost and found.
a song.

1o. Do you want someone to be with you right now ?
erm i dun wanna be a loner. so yeah. haha.

11. What was the time you went to bed last night ?
11.54pm. haha. i hate dreams.
they are pure evil. they eat up my sleep time.

12. Where did you buy the tee you are wearing now ?
erm. ou its actually my pjymas.

13. Is someone on your mind right now ?
yeah. yeah. guess who pn norsham. omg i just 'LOVE ' her so much.
she scolded me infront of erm. nvm. during anugerah anyway.

14. Who was the last person(s) who text you ?
liyen;)
and celcom haha.

TEN Lucky Person to do this quiz...
1. alex.
2. yiyuan
3. shuyan.
4. james
5. huiwen
6. yee vonne.
7. firb.
8. sophie.
9. eric
10. liyen.

15. Who is no.2(yiyuan) having a relationship with ?
erm. ask him laa. =)

16. Is no.3(shuyan) a male or a female ?
does the name sound like a male? == slimmy shuyan.

17. If no.7(firb) and no.1(alex) get together , would it be a good?
haha. shuyan will cemburu LOL.

18. What is no.1(alex) studying about ?
alibaba's diary.

19. When was the last time you chatted with them ?
erm. diff ways laa.

20.Is no.4(james) single ?
LOL. yeah i tink.

21. Say something about no.2(yiyuan)
he always say others are werid except him. haha.

22. What do you think about no.3(shuyan) & no.6(yee vonne) being together?
erm why so les wan tis tag?
i dunno.

23. Describe no.9(eric).
he is not bald animore. and erm beg poeple to print his logo for him.

24. What will you do if no.6(yee vonne) n no.7(firb) fight ?
aiya wun one laa.

25. Do you like 8 ?
YES OF COURSE!

i go do hw. bye.
zoro! LOL.

xigua hate watermelon for once.

2009-04-13T21:09:00.002+08:00

haha.

PBSM rocks.

and pull up yr socks.

LOL.

i'm not going recruit camp.

stupid sick laa. put name edi then cannot go.

i nvr go recruit cap b4 and haiz... peluang FLY.

oh ya, why did yr dad throw the butter out of the window?

because he wanna she BUTTER-FLY!

p-p-p-poker face p-p-poker face.

addicting song.

i seriously feel hungry.

haha. ciaoz.

TOH, do u have a blog? LOL.

miss celine: TOH, why u so talkative since u come here ar?

LOL. she's from skdu last time.

get to know her.

she is damn funny.

and perasan to the maxx.

and omg. u noe yr name read backwards is HOT!

ahem.

ok seriously bye. haha.

fat women being horny.

2009-04-10T19:55:00.002+08:00

this pic just look way wrong man.
super big g-string LOL.
i nominated her as

"the fattest woman on earth."

haha.

tmr cant go. haizz. tell me why ~

stupid sickness.

i'm gonna die.

TOUCH WOOD.

=((((

yer not fair laa...

weird tag.

2009-04-03T18:42:00.002+08:00

my waist damn pain. haha.

Dear (the last person who left a comment on your blog):I don't really know how to tell you this, but ___1___. I think I realized it ___2___ ___3___ and I saw you ___4___ ___5___. I'm sure you're ___6___ enough to understand ___7___. I'm returning ___8___ to you, but I'll keep ___9___ as a memory. You should also know that I ___10___ ___11___ .___12___,-Your name

1. What's the color of your shirt?
Blue - Our romance is over
Red - Our affair is over
White - I'll join the monastery
Black - I dislike you
Green - Our horoscope doesn't match
Grey - You're a pervert
Yellow - I'm selling myself
Pink - Your nostrils are insulting
Brown - The mafia wants you
No shirt - You're a loser
Other - I'm in love with your sister

2. Which is your birth month?
January - That night
February - Last year
March - When your dwarf bit me
April - When I tripped on sesame seeds
May - First of May
June - When you put cuffs on me
July - When I threw up
August - When I saw the shrunken head
September - When we skinny dipped
October - When I quoted Santa
November - When your dog ran amok
December - When I changed tennis shoes

3. Which food do you prefer?
Tacos - In your apartment
Pizza - In your camping car
Pasta - Outside of Chicago
Hamburgers - Under the bus
Salad - As you ate enchilada
Chicken - In your closet
Kabob - With Paris Hilton
Fish - In women's clothing
Sandwiches - At the Hare Krishna graduation
Lasagna - At the mental hospital
Hot dog - Under a state of trance
None of the above - With George Bush and his wife

4. What's the color of your socks?
Yellow - Hit on
Red - Insult
Black - Ignore
Blue - Knock out
Purple - Pour syrup on
White - Carve your initials into
Grey - Pull the clothes off
Brown - Put leeches on
Orange - Castrate
Pink - Pull the toupee off
Barefoot - Sit on
Other - Drive out

5. What's the color of your underwear?
Black - My best friend
White - My father
Grey - Bill Clinton
Brown - My fart balloon
Purple - My mustard soufflé
Red - Donald Duck
Blue - My avocado plant
Yellow - My penpal in Ghana
Orange - My Kid Rock-collection
Pink - Manchester United's goalkeeper
None - My John F. Kennedy-statue
Other - The crazy monk

6. What do you prefer to watch on TV?
Scrubs - Man
O.C. - Emotional
One Tree Hill - Open
Heroes - Frostbitten
Lost - High
House - Scarred
Simpsons - Cowardly
The news - Mongolic
Idol - Masochistic
Family Guy - Senile
Top Model - Middle-class
None of the above - Ashamed

7. Your mood right now?
Happy - How awful I've felt
Sad - How boring you are
Bored - That Santa doesn't exist
Angry - That your pimples are at the last stage
Depressed - That we're cousins
Excited - That there is no solution to this
Nervous - The middle-east
Worried - That your Honda sucks
Apathetic - That I did a sex-change
Ashamed - That I'm allergic to your hamster
Cuddly - That I get turned on by garbage men
Overjoyous - That I'm open
Other - That Extreme Home Makeover sucks

8. What's the color of your walls in your bedroom?
White - Your ring
Yellow - Your love letters
Red - Your Darth Vader-poster
Black - Your tame stone
Blue - The couch cushions
Green - The pictures from LA
Orange - Your false teeth
Brown - Your contact book
Grey - Our matching snoopy-bibs
Purple - Your old lottery coupons
Pink - The cut toenails
Other - Your memories from the military service

9. The first letter of your first name?
A/B - Your photo
C/D - The oil stocks
E/F - Your neighbour Martin
G/H - My virginity
I/J - The results of your blood-sample
K/L - Your left ear
M/N - Your suicide note
O/P - My common sense
Q/R - Your mom
S/T - Collection of butterflies
U/V - Your criminal record
W/X - David's tricot outfits
Y/Z - Your grades from college

10. The last letter in your last name?
A/B - Always will remember
C/D - Never will forget
E/F - Always wanted to break
G/H - Never openly mocked
I/J - Always have felt dirty before
K/L - Will tell the authorities about
M/N - Told in my confession today about
O/P - Was interviewed by the Times about
Q/R - Told my psychiatrist about
S/T - Get sick when I think of
U/V - Always will try to forget
W/X - Am better off without
Y/Z - Never liked

11. What do you prefer to drink?
Water- Our friendship
Beer - Senility
Soft drink - A new life as a clone
Soda - The incarnation as an eskimo
Milk - The apartment building
Wine - Cocaine abuse
Cider - A passionate interest for mice
Juice - Oprah Winfrey imitations
Mineral water - Embarrassing rash
Hot chocolate - Eggplant-fetishism
Whisky - To ruin the second world war
Other - To hate the Boston Celtics

12. To which country would you prefer to go on a vacation?
Thailand - Warm regards
USA - Best regards
England - Good luck on your short-term leave from jail
Spain - Go and drown yourself
China - Disgusting regards
Germany - With ease
Japan - Go burn
Greece - Your everlasting enemy
Australia - Greetings to your frog Leonard
Egypt - Get Lost now
France - In pain
Other - Greetings to your freaky family

haha. sure damn random.

Dear William,

I don't really know how to tell you this, but you're a pervert. I think I realized it when you put cuffs on me at the mental hospital and I saw you sit on Manchester United's goalkeeper. I'm sure you're scarred enough to understand how boring u are. I'm returning your memories from the military service to you, but I'll keep the results of your blood-sample as a memory. You should also know that I always try to forget Oprah Winfrey imitations.

Go ad drown yourself,
Jess.

LOL. totally agree with the pervert part. ok maybe not pervert
horny is the word. horny tofu. te whole thing does make any sense.

i tag: anyone who's names starts with z.
haha. technically no one. good.

bye. =) lame tag.

LOL

2009-04-03T18:06:00.002+08:00

haha. aj and grace taught me this

LOL.

haha.

lame. good luck for

the thing.

u guys can do it.

i want to see the cd! haha.

see how wai we go prize. haha.

this yr cant participated.

mummy dun let :(

watch slumdog millionair just now.

nice and i dunno why i laf whe i watch

they are really some good beggar.

i mean cool

they steal people's shoe and sell them.

crap the taj mahal's history. haha.

dat part is quite funny.

and i didnt cry haha.

sc centre. haha. hope xy can go. i mean must go.

dun ffk. dunno want go du rally tak. =)

pn chong found my chinese blue bk

she said it just appear like that *

hrm wth. i bought another bk

and paste some notes down liao.

I always bring phone for a reason laa.

kim tan kim tan haha.

hehe. happy belated bday shafiq and happy before bday grace!

child abuse is bad. dun tickel them. haha.

go mandi.

kena april fooled!

2009-04-02T17:14:00.003+08:00

kena april fool so many time.
hrm.
ur shoelace.
ur pants dirty.
u didt zip!
haha.

today hyper again.
teachers went for meeting.
WOO. and i finish my hws.
laf non-stop with alex.
i dunno why.
when she laf i laf.
when i laf she laf.
then that william
or izzit eric.
nvm. made a how to say.
like choose a colour eg: PINK.
then P-I-N-K pink.
then got some numbers on the paper.
u suck haha.
vagina. swt.

i hope i pass the test.
gonna cut my hair.
cos front there BOTAK.
oh ya ALEX shud go balded.

i really suck in jump shots.
jump higher.
1 2 3 jump.
drop. haha.
must practice!
william is such a poser.

life is random so am I.
nvr tried typing chinese words b4.
mm hmm.
曾薇桦 jess.
阿拉善地亚 alex.
蔡淑彦 shu.
红杰如 jieru.
张盛瀚 james. sry ar. =)
林伟强 eric.
周显礼 will.
朱欣韵 xinying.

praying.

2009-03-30T19:08:00.002+08:00

oh god, pls let us finish our lawatan and back 4 koko on time.

amen.

haha. tell you something. i'm praying so hard because.
on last saturday,
haha
james, william and me.
went to the sas haha
then guess what? it's CLOSE.
erm. thats a lot of people waiting there too
haha. we are gg lor.g square.
then the guard asked us to go muzium negara for more infos.
haha. geng go there ntg.
nothing at all.
haha. hrm. looking at them eating ice-cream.
thretening.
LOL.
then go arkib negara.
GUESS WHAT?
CLOSE.
how "yeng" is that
we waste all our time.
william kill his tuition.
LOL

then tmr we are going again.
after school.
but already made sure tmr will open.
so erm no worries.
eric and grace are following too.

i tink i just shum tong cos of the petrol fee.
haha. oh ya, after that, gonna rush back for koko.
no more surat amaran pls.

i just say hey then he off to tuition.
great.
haha.
"GREAT LAA JESS"
LOL.

tmr will be a rushy day.
good luck jess.

satisfying.

2009-03-27T18:20:00.002+08:00

got back all the exam papers except PJK.
lol. i tink i'm gonna fail for dat.
so who cares?

i'm quite satisfied with my results.
malay 84%
english wrong one.
chinese 85% (or izzit 83%) dunno laa...
and my chinese blue bk lost liao. damn it. but not my fault. so weird.
i think the thief start to steale again. so many things lost lately.
like james mah textbk, grace's sivik bk, alex's maths 1 and jieru's calculator.

O.O
continue with the marks.
maths 96%
science 94%
geography 94%
haha. i actually circle the wrong answer in the questions paper and hitam the correct one.
geng. haha.
sejarah wrong erm 6 quos.
now i noe that setanak nasi is the time which takes to cook rice. haha.
kh 98% haha. mhmm mm.
seni wrong 12. haha. i didnt even open the bk. cool.
moral 92% dun care. cant take wirda's voice. man, stop shouting laa...

geo project see-pay long. when can finish? lazy to do.
i tink i'm at pendahuluan only.
cant go the earth hour thing at cape square! have fun people~
oh ya, save the earth from global warming.
switch of ur lights for only an hour.

haha. vote for david archuleta to come to our school at hitzfm.com.
haha.
cant imagine when he really come. but maybe he cant even go in to smdu.
cos she maybe gonna stop him. ok just say that he can understand bm.
" lu siapa? mengape masuk ke sekolah?"
"i'm david archuleta."
"david apa? siapa tu?"
"i'm from american idol."
"american idol? saya tak tau!"
haha. then archuleta sing.
is too nice until she faint. go to the hospital now.
lol.

life is random. so am i.
nvr say cheerio.

Touched >.<

2009-03-23T18:53:00.002+08:00

today 23/3
i feel
erm....
tOUCHED.
pn ng is so kind.
she saw me coughing non-stop.
she gimme a fisherman sweet haha.
hhaa. it didnt get better...
but
still she's so kind.

she also ask me not to sweep the floor.
haha. what a slacker i noe.
but sick ma =)

she has temper sometimes.
but in deep heart, she's really kind.
i feel touched.

mhmm... marks.
kh 78/80.
english. 39/40.
not bad hur. haha
angkat diri punya.
oh ya, william has te same marks too.
lol
not sure about others.
charm being kiasu again.

PN NG LEE CHU BATU!
"haha. rock=batu. better specify. ltr teacher thought stooner pula"
LOL.
((O.o))

Life is random so am I.

Tuts My Barreh.

2009-03-22T14:02:00.001+08:00

lol. korean version of Touch my body.

hahahahahahahahahahahahahahahahahahahahahahahahahahahaha.

sure laugh.

man. the voice.

haha. enjoy.

jail jail jail... .3 times.

2009-03-19T16:28:00.002+08:00

yesterday
18/3
went mcd disscussing camp stuff...
i QA? haha.
alex and xinying came LATE.
fashionably late.
then when ngam ngam 12.00pm,
eat mcd haha
RM 5.95.
i ate er...
chicken burger.
alex oso.
xinying busy doing her tuition hw.
then continue meeting.
vp and jie lin came and tell us those imp. things.
haha. stress james out.

then kb, jo ee, jia min, shern and jc(haha another jc)
walk to pei wen's house.
which is quite far from msd.
near bkt kiara.
but they are freaking
FAST. haha

oh ya, denise, lx, xy, me
sit peiwen's gong gong car to her house
we played....
MONOPOLY.
malaysia version.
haha. old kent road is erm...
Petaling street.
cheapo place laa...
build hotel oso still CHEAP.

jo ee+ denise,
jia min+ lx,
shern+james,
xy + jess,
kb + peiwen.
team up cos $$ not enuf 4 all.

"wanna buy jail free card?

for 2000?"

haha. of course not. lol

kb and pei wen own so much....

jo ee and denise almost bankrap

jia min and lx... geng build 2 hotel.

make people bankrap.

shern and james kena coned.

haha.

denise haha. need to go home early.

cos....

haha.

"not skiok edi laa, jiamin sure win! "

oh and alex too.

then sao dong. keep shushu.

haha.

shoe.

the distorted horse!!!

hahahahahaahahah.

alex tumpang cos need to wait for pink finish pat too.

when home. alex played ronald's phone.

haha. the pao pao long so slow.

move slower then i walk.

bring lx down then her popo ask

"can we park here? is this suppose to be correct?"

the myvy was parked at someones spot.

hahahah.

then lx went back lor.

wait to do facial

haha. rachel jeje ar,

the facial lady today at yr house haha.

then see mt cousin punya pimple Burst.

haha.

"dun laf so much, ltr u oso got.."

that aunty said.

at night go ikano/ikea.

until they close haha

then buy cheap foods.

they need to sell all b4 closing their shop.

so we help them.

tun jie, evil dude.

bye.

making my way down town.

2009-03-16T11:40:00.002+08:00

most of my title are RANDOM.

totally ntg related to my posts.

nvm. =D

"Boo!"

dun scare me like shit crap.

haha. SHIT CRAP?

my avg anti virus.

need to upgrade.

and $$ is needed. haha

alex just came back from camp yesterday.

" or is it saturday? erm. not sure."

malcolm was forced to be gentlemen.

lol. emphasize the FORCED.

alex, blog blog blog!!!

haha.

i'm sick!!!

i used up

2 rollssss

and 2 boxes of

TISSUES.

" IN 2 day!"

my temperature is 35.4 'c now.

i'm erm cold blooded.

like vampire haha. i just watched twilight.

" whao now only watch ar?"

haha. yeah.

and i watch the hor got the kiss scene!

LOL.

FOO TUN JIE!

yr virus.

argh. spread spread...

then reach to me.

nooooo... anti-virus failed.

then sick.

u see... u erm...make me sick

make me mhmmm...

no appetite.

no ice-cream!!!

no mood to go out.

sleep without air cond.

u must pay me back.

haha. belanja me er...

gelato. "ar... feel like tasting it!"

oh ya. medical fees too...

$$$

those bitterish evil pils.

haha. tun jie.

"better watch out!"

jk laa. haha.

but at least i still can talk.

sing.

oh ya, rmb people on

28th MARCH 2009.

8.30-9.30pm.

pls turn off yr electricity

i mean dun watch tv,

dry yr hair

no light.

no com.

search 4 yr torch.

and haha. candles.

save yr electricity!

for er... 1 hour.

then on it back at 9.31pm.

haha. that simple.

i go take medicine bye~~~

be optimistic!

2009-03-13T22:04:00.002+08:00

and of course all the people u hate are going to eventually die.

exam is
FINALLY
TOTALLY
EVENTUALLY
HAAA
over...

shouldnt think of results.
holiday...

geo sej projects.

movies

h/wsss.

com.

ou.

pool.

court.

food.

are waiting 4 me to finish them! "sound like killing them"

haha. my frens are crazy

cool

retard(me oso la)

lame

but i loveeee them.

la selle campfire cancelled.

haha. i wanna go but didnt get to go. and now

cancel.

anything can happen.

be optimistic.

maths 96

86 bc.

totally pullin down my marks.

cool losers

are they such things?

loser tetap loser.

feel like drinking milk.

bye.

danny batu!

2009-03-12T17:37:00.004+08:00

Danny Gokey

american idol top 13

he really batu!

his vocal is

WOO~

he dun really look erm 'not ugly'. =\

but he is good geng yeng when he sing.

his dancing erm no comment =)

LOL.

'I Want To Love You

Pretty Young Thing

You Need Some Lovin'

Tender Lovin' Care

And I'll Take You ThereI Want To Love You

Pretty Young ThingYou Need Some Lovin'

Tender Lovin' CareI'll Shake You There'

he is totally going into finals.

amazing performance of he's.

haha.

NO MORE nerding...

1 more day.

nicole ann david is an artist?

who knows ryte.

erm. God knows.

"wankembangcapmohorzinakempetaisaitaringanuohyaHOABINH"

2009-03-11T21:52:00.004+08:00

sejarah
sivic
english

then friday.
kh
bm
and PJK...

cant wait till exam end laa.
i cant go to the la selle campfire.
pity me.
cos...
it reach space limit liao.
its too late....
its too late.

lalalalalala.... coping with my stress.
stress suddenly became my buddy.
stress change to E
then become E-buddy
LOL. dunno how to use it.

syajaratunpokokmalagahmalatapekatulahKadazandusunbajausulukearringtuairumahdatukbandarbeliungsiputgewengcalainschenghopegupasarbodyguardsrivijayahinducandifunanbarray
arh... i fell better.

"nvr hate sejarah.

sejarah is nice... "

i'm telling this to myself.

no sivik bk then no need study.

haha as easy as that.

LOL. wat a random incident.

someone added me as a fren in skype then...

[10:06:22 PM] Lim Sheau Yun: Please allow me to see when you are online

[10:06:36 PM] jessica chan: jessica chan has shared contact details with Lim Sheau Yun.[10:06:52 PM] jessica chan: hey do i know u?

[10:06:54 PM] jessica chan: =)

[10:07:01 PM] Lim Sheau Yun: oh

[10:07:04 PM] Lim Sheau Yun: i dont know

[10:07:04 PM] jessica chan: er...

[10:07:11 PM] jessica chan: from penang huh[

10:07:19 PM] Lim Sheau Yun: yea

[10:07:31 PM] Lim Sheau Yun: i think i got u mixed up with someone else

[10:07:33 PM] Lim Sheau Yun: sry

[10:07:36 PM] jessica chan: so u noe me ryte?

[10:07:42 PM] jessica chan: owh

[10:07:47 PM] jessica chan: okay.

[10:07:54 PM] jessica chan: nice to meet u then.

[10:08:16 PM] Lim Sheau Yun: yea

this seems so formal.
haha.
Lim sheau yun.

"how may jessica chan are there in the world?"

and she so ngam from penang.

where i was born.
where anjelee was born.

nites.
i slept so much today
=(

having 3XAM fever ...

2009-03-08T22:34:00.005+08:00

read it from the third pic.

" dun blame me wor. blame the photo uploader.

it suppose to be the other way round."

looooooo....
MMMM

CHar....

CHARM LOR...

exam exam exam stress stress stress....

and yeah.

BOOKS BOOKS BOOKS.

Books....

and there are MORE...

exam is coming in er...

2 days time.

" mutha flower, why so fast!!!"

but think of the

BRIGHT NICE STReSS FREE side,

Holiday is coming to town.

ok what can i do in 2days time.

with lots of subjects that havent done studyed...

memorised, ar... sej, geo, kh, sc

bm bi and haha

PJK.

LOLOLOLOLOLOL.

she actually ask us to study.

study study study...

haha. but i still

swim...

play badminton...

eat shit sleep of course.

When exams are near,

they causes fearrrrrrr,

because things aren't clear.

(die liao die liao. i'm starting to crap.)

Erm.

Babs and Babs,

haven't been studyed,

problems and problems,

haven't been done.

Some revise and re-revise,

some just seen for the 1st time.

Some are cool and calm,

some are tense and cham.

oh where's my books?

where's my pen...

my propro...

aiyor what is the one ar ar...

the answer ar...

man i forgot again...

My heart is beating fast,

faster and faster...

I felt my head would blast.

explode!!!!

whoa sound so kuajiong.

g/night.

"dun dream about exam.."

i wish to wish the wish wish!

hope we can get good results laa.

BSMM marching

2009-02-21T22:48:00.003+08:00

after those scolding, pumping, sweating, painess and even butt cramp!.

dun ask. and er... becoming almost a black woman and sunburn and

the weird white line thingi produced by my specs. indirectly laa.

we won 4th. woot! yay~ no more waking up early on sats and can go church on sun.

no more aiya here and there.

pkbm won 1st. congrats hakim haha.

2nd kadet polis. no COMMENT. if u get what i mean.

3th Scouts. they really deserved it. haha. the commander ken vern tripped abit. ceh i thought what party! if u dun get it, nvm!

BSMM deserved it too...

to the st john's

u all didnt win not because u all not pro. u all damn pro laa ok. like grace's ankle sprain still can marching so chunted. g. ling and myy ur marking very yeng! haha.

just because of some ****** problems nia.

bsmm can win first next yr. if we try hard hard and harder.

be more seragam... and er.... etc.

we are the champions my fren...

that song....

haha.. sexyback yeah~~

haha. mother**** lol

fall fall fall...

we help 5 casualties nia. haha.

go ungu!

then pn rohaizah anounced: tempet ke-6- ungu.

haha. not everytime laa...

ungu tetap unggul.

one blue big family

kuning truly different.

jess, alex and xy.

nites. msn always have updates huh.

it take so long to update.

tmr marching...

2009-02-06T20:54:00.003+08:00

sports day is around the corner...

erm... 12 more days...

whoaliao so fast.

*scare myself je*

marching today then tmr.

haha. alex coming my house after practice.

owh shuyan not in the marching thing liao.

cos she can serve better in the first aid team.

haha. sounds familiar huh?

haa.

the prs interview thing was not success.

haizzz...

why? sad case.

then join LEO with xinying and xueer.

it was fun i bought two stuff. haha.

i didnt buy the I love girls cos it's gay. haha.

LOL.

valentine's day, everyone xik zhou. haha

william bday lol.

and jz's birhtday 13th. haha.

clelebrate in camp.

LEADERSHIP CAMP.

is b4 sports day.

oh ya, Why don't sheep shrink when it rains?
make me wonder...

herm...

maybe they dun imbibe...

Im Bi Be...

haha.

hakk hay.

so hakk hay.

done. bye~

21/1/2009

2009-01-21T17:47:00.002+08:00

haha. morning session for me is so tiring.
haha. morning session= morning +afternoon.
afternoon stay back for koko ma. aiks for 3-4 days a week.
march in pbsm meeting just now.
my feet pain liao. haha.
i hope my marching skills can be BETTER =)
i cant go for marching practice at this friday and saturday.
sad case need to Balik Penang.
gonna ponteng satu hari.
no big deal.
hope the PRS interview can be sucessful cos i wanna be a PRS.
obviously.
i wanna help myself by helping others too.
i like the Badge also.
haha. thats one part of my answers for the WHY DO U WANNA JOIN PRS QUO.
lol.
i mean i love the Badge.
okay. now is 5.54 pm.
i think i wanna go fetch my bro with my mum.
bye

Kiambang 09

2009-01-10T11:12:00.002+08:00

i'm in Kiambang.
most of the 2 terataians are in too.
but not sharmaine, najla anf reeqa.
=(

so far, the teachers are quite nice.
bm- pn zaiton. she's ok.
english- pn azidah. our class teacher oso.
geo- pn phua. she say hermalay very bad. worst tha us lol.
sej and seni-pn rohaizah. she's quite pro in sejarah.
science- pn ching. jun xong's mum haha.
maths- cik lee. she vey nice but i just dun get why MATH? not MATHS.
kh- pn ng. humourous. haha. gerald, u didnt give back yr spbt bks ar?
moral- cik wirda. she didnt turn up for her class. cos she's dealing with some pendaftaran asrama thing.
MM- not sure.
PJK- pn azizah.
sivic- pn phua. haha.
chinese- pn chong. next monday gonna start liao. then after that, need to rush to celine's tuition lol!

Kiam
bang.
ltr gonna buy the materials for the jadual waktu.

ok. it's gonna be okay. ryt?

2009-01-04T21:53:00.002+08:00

today: jan 4.
about 8 hours till school reopens.
i can be calm.
i tink =).
must be optimis.
anyway. i'm going 3 kiambang.
it's the best class this year.
i'm just worry...
can i be classmates with my friends?
aiya. sure can laaa...
shud be laa...
totally berserah kpd tuhan. lol
haha. i bought another bible today.
quite expensive but good investment.
it will be with me forever.
until i die. aiyor choy. haha.

i wun be nervous, scared.
cos rachel's mom say i'm crazy. haha.
i dun wanna be sampat po! haha.

ok. i think i have everything.
pencil case, a notebk and a file.
thats it.

shoot where's my bag?
i go find dulu.
*15 minutes ltr*
woot~ i found it!
it was above my cupboard.
what in earth was i thinking when i put it up there?
anyway, i dun rmb anything.
i'm so blurr now.
let me make things straight. not crooked.
when sophie ask me to give her cindi's email add, i gave her her phone num!
weird laa. shit!
i cant be blur anymore.
holiday is almost over.
few more hours. haha.
so depressed.
bye... i nid to sleep.
goodnight.
you may be now thinking i'm too over.
but thats me.
sometimes sot sot dey.

love, jess.

jessica LOL

2009-01-02T17:32:00.000+08:00

typing upside down IS fun! muahahahaha

¡nɐd ƃuɐ ʇuɐʍ ı 'dn ƃuıɯoɔ ɹɐǝʎ ʍǝu ǝsǝuıɥɔ ¡unɟ os ʇnq ˙˙˙˙zɥǝן pɹıǝʍ 'ʇɥƃıɹ ǝɹ,noʎ ɥǝ ¡ɐɥɐɥɐɥ ¿ɥǝ ʎuunɟ ʎɹǝʌ

very funny eh? hahaha! eh you're right, weird lehz.... but so fun! chinese new year coming up, i want ang pau!

and we are so evil

Penang Trip part 1

2009-01-02T12:29:00.004+08:00

ok. let me blog about my penang trip.

penang is my hometown. haha. laksa bestlah~

lol.

owh ya. i actually went to taiping first to see my ahma and ahma's borthers(gong gong). they live in an atap house. ok ahma's is not that poor ok. she was just there to take care of her bros. cok for them. help them clean the house. that really takes a lot of effort. haha =). btw, she's now living with us but just within 2 weeks time. it was raining that day. so cant really run around and chase the dogs and cats. lol.

cant even have THOSE OLD TIME ICE-CREAM. (bingbang)

mos of the things there are quite antik & old. it was there for 40-50 yrs.

look at the jalan. they are not even terturap. haha.

AJ 4987. haha. neighbour's motorbike.

old chairs.

the chua family's picture. and a clock.

ignore this picture. it's the same pic.

ok ltr we continue our journey to penang.
cross the penang bridge...
blah balh thn reached at my uncle's house lor.
nothing special.

introducing my cousin, vincent.
he got 1st for piona idol.
then got 300 rm. haha. we asked him to belanja us. and he say okay. wow.
btw, he's only 7 y o. he is trying out violin too.
he had free violin lessons form his piano teacher .
the teacher says that he is so talented in music.
and he is very pro in study too...

vin. jason. ronald. jessica

jason .jessica.

this is aunty sue.

she's from thailand. haha.

he taught me how to play piano.

guess how???

by sticking stickers that say do re mi fa so... haha

i noe i'm bad in this.

oh yea, taught me singing too.

he's like:

off pitch. off key.

argh. he make me mad.

but he is a great teacher. haha.

to b continued. bye.

love, jess.

merry christmas and happy new year

2008-12-31T18:11:00.002+08:00

actually it's belated christmas.
haha.
i wish everyone to have a happy 2009.
a happy new year...
time to forgive people and start a new life.
see u next year! i mean i 5 days time. haha.
btw, what time does school start? haha.
i'm blur now.
the sequence of my holiday:
bored-fun-bored again-happy-funny-sad.
cos my cousins are leaving.
sobs. i think i'm a bit childish to play snake game with a 7 y o and a 12y o?
oh yea, about th new LG phone, its quite nice.
got snake game de leh... haha. then you shake the phone to roll the dice.
but the comp alwiz win. not fair.
so cheating.
omg. why am i taking about snake game?
haha.
2008's last post.

love, jess.

battleground

2008-12-30T16:12:00.006+08:00

this battleground thingi from so long ago. and i didnt get to blog about it. haha.
i blog lor.
tha particular day: friday( not sure )
date: 12/12/08
...
er... i was out to ou with my mom and bro. we ate zanmai sushi. haha.
then we went the new wing main entrance to watch the battleground thing.
...
it was about 2 pm.
and they are still preparing.
then saw eric and james lor.
... 2.30...
3.00...(the comp still not yet ready...)
my bro suddenly said TIRed.
so annoying. and my mom said lets go home. haha
lol. then technically i cant watch it. haha.
funny ryt...
but i watch the comp on the tv though haha.
i support:
Twister Genies.
ECX.
and ultimaxx.

steal from google.

and i took this.

bye.

love, jess.

p/s: congrats to the form 3sthat got straight A's for PMR.

and good job to who that got 7As and B(chinese) haha.

seems that chinese is hard. hard lik a rock. next year is our turn liao.

The Black hole.

2008-12-22T17:42:00.002+08:00

haha. he is so geedy...

Greed will imprison us all.

I wonder if they'll find him.

After all it's a dimly lit room where the light bulb is out

and it seems no one goes in there. haha.

bye.

♥ jess ♥

trying stuff...

2008-12-22T16:33:00.004+08:00

http://www.myheritage.com/collage

haha. i look like a black woman?

weird...

try it.

i have another one at the end of my blog. cos it's too big.

argh...

2008-12-16T11:41:00.002+08:00

my chatbox...
is so polluted by some ppl.
haiyor who is that justaguy?
and crazy william laa..
ignore the chan wei siong thing!
ad what two frens man.
shuyan and james.
still say william so geng...

bye.
jess.

abcdefunny...

2008-12-14T11:45:00.000+08:00

whoaliao so long.

THE 1st THING THAT COMES TO YOUR MIND.

A
available : available to be frens.
Age : 14++
Annoyance : ~~ronald~~ rats and cockroach.

Animals : Hippo. and er... dogs.

B
beer : root beer.
Birthday : 9th June 1994
Best friends : all of u...
Body part on opposite sex : huh? ~~six packs~~ muscle.
Best feeling in this world : joyful
Blind or deaf : handicaped.
Best weather : sunny but windy.
Been on stage : sure.
Believe in magic : yes. magic magic magic.
Believe in santa : yeah. santa claus is coming to town.

C
Candy : colourful candy.
Colour : blue and black.
Chocolate or vanilla : Chocalate
Chinese or Mexican : cina laa. cina lagi best la.
Cake or pie : cakess... but apple pies are nice too...
Continent to visit : sahara desert.
Cheese : sure but not too much.

D
Day or night : day. night just ~~slumber party~~ sleep oni.
Dance in the rain : nice ~~ltr acid rain then hair and skin become green.~~ haha.

E
Eyes : ~~eyemole~~ blue eyes are perfect.
Everyones got : time. and hair now.
Ever failed in class? : maybe. see failed in what dulu.

F
First thought waking up : ~~why mut wake up leh. let me sleep more!~~ today is a new day! *copgrighted from chicken little*
Food : chicken haha. i love chicken.

G
Greatest fear : ~~the darkness~~ no mummy daddy family and frens.
Goals : straight A's and have a meaningful life.
Gum : u want gum gum? but i dun have gum gum. so go beli yrself la.
Get along with parents : of course. they give birth to me leh.
Good luck charm : to sueying, i'm still keeping the good luck charm u gave me from like ages ago. haha.

H
Hair Colour : i want colourful hair! gatsby... always yr smartest choice.
Height : ~~129 when i was 7 y o.~~ haha. 169 cm.
Happy : =)
Holidays : boring... fun... singapore... genting...
How do you want to die : ~~squash under kungfu panda's butt.~~i wanna live.

I
Ice Cream : gelato and haagen daaz.
Instrument : guitar... i have it but dunno macam mana play.

J
Jewellery : diamond type.
Job : handy manny. anthony's workshop~~

K
Kids : cute and chubby. ~~but not ronald.~~
Kickboxing or karate : kickboxing.
Keep a journal : nope. i have blog edi wurd. no nid jurnal laa.

L
Love : born from ur heart.
Laughed so hard you cried : yes. when shushu tell me the ghost thingi goes like... haha.

M
Milk favour : milkshake=)
Movies : no... x files. i'm still fearing it.
Motion sickness : sad.
McD or BK? : mcd cos i dunno whats bk~

N
Number of siblings : 1
Number of piercings : 2. for earing ma.

O
One wish : daddy and mummy can be healthy. haha. the ray j song.

P
Perfect pizza : homemade. can put as much stuff u want. haha. but retarded looking!
Pepsi / Coke : coke.

Q
Quail : eyemole. aik ltr grow hair leh!

R
Reasons to cry : brokenhearted.
Reality shows : funny? and real life?
Radio stations : fly.
Roll your tounge in a circle? : cant even do that!
Ring size : tak tau...

S
Song : disturbia...
Shoe size : 5-8 depends on the cutting.
Salad dressing : my mum does that.
Sushi : unagi!
Slept outside : ya laa.
Skinny dipped? : haha. no. ~~but dun col me fat~~
Shower daily : 2 times.
Sing well : i love to sing!
In a shower? : i sing laa. and squek squek..
Strawberries / Blueberries : strawberries short cakes...

T
Tatoos? : dun wan. will regret de.
Time for bed : 11.00 pm.
Thunderstorms : bing bang boom...

U
Unpredictable : future.

V
Vacation spot : beach~

W
Weakness : cant wear high heels. dun laugh, alex! haha but one day i will... i tink
Which one of your friends act most like you : they dun act.
Worst feeling: alone.
Wanted to be a model : yes.
Where do we go when we die : heaven or hell.
Worst weather : stormmy and raining heavily.

X
X-rays : cool.
EX's : exclusive.

Y
Year it is now : 08.
Yellow : egg yolk.

Z
Zoo animals : chubby lion.

done. lol. watching sperheroes movie...

bye.

♥ jess ♥

Sweet Christmas.

2008-12-11T17:12:00.000+08:00

the chick is sosososo adorable.

so sweet.

so cute.

ahaha. i love the eyes. haha. BIG and CUTE.

bye,

♥ jess ♥

10 dec 2008.

2008-12-10T15:54:00.000+08:00

weather: cloudy
emotion: okok

" I have a dream, a song to sing."
and " we are the champion, my frens. we'll keep on fighting till the end..."
is stuck in my head.
dunno why.

i googled the word bored.
and bored.com appear.
haha. dats reli what i nid.
http://www.bored.com/
and there's an ad- How i lost 17 pounds of stomach fats in 4 weeks!
then there's a picture of a sixpack guy.
this reminds me of the
no nid exercise
eat the more junk food u can
way to get six packs from tun jie's bloggie
haa.
go see his blog for more info.
http://mybrainisscrewed.blogspot.com/

then i read some jokes and etc.
some are really funny.
and i found Mystical Ball.
it is so cool.
then i told alex to go check it out.
haha.

today i makan at downstairs.
then dapao for dinner.
my mom, ron and me take turns to play astro pop in ps2 today.
lol.
i'm the highest score.
haha.

p/s: i'm going sg nex week.
i'm not the wth kind! haha.
i'm the haha kind...

~~cheerio~~ byee~~

♥ jess ♥

erm. i like buterfly!

2008-12-09T15:36:00.000+08:00

finally doing this thingi. LoL.
and thanks for nominating me so long ago, shushu! haha.
so now its my turn to nominate 10 orang.

1. ~~jess~~ alex.

2. ~~jess~~ shuyan.

3. ~~jess~~ james.

4. ~~jess~~ eric.

5. ~~jess~~ allysha.

6. ~~jess~~ yee vonne.

7. ~~jess~~ yi yuan. ( although his bloggie still underconstructing. )

8. ~~jess~~ clement ting.

9. ~~jess~~ ching wen.

10.~~jess~~ pn shah.

haha. done.

twilight didnt beat harry potter.

lol. and the two rabbits have just born 4 rabbit.

got black laa.

got black and white laa.

got.2 white de.

so coloursist.

so cute leh.

next time if i see them again, i will take some pics.

i read 2 chaps of twilight today.

haha.

bye.

♥ jess ♥

clement has a penyakit col hernia. whats that? why nid to take off ur pants de? haha.

heights.

2008-11-29T17:54:00.000+08:00

A lot of people are afraid of heights.
that call acrophobia.
but Not me,
I'm afraid of widths.
lol. i dun wanna be fat.
haha. i'm 52kg now.
i noe i'm fat=(

song: t-shirt

bye.
♥ jess ♥
and i love teddy bear.

=)

2008-11-24T16:59:00.000+08:00

I know a song that gets on everybodys nerves,

everybodys nerves, everybodys nerves,

i know a song that gets on everybodys nerves and this is how it goes!

I know a song that gets on everybody nerves,

everybodys nerves, everybodys nerves,

i know a song that gets on everybodys nerves and this is how it goes...

haha. i'm totally wasting mine and ur time^^

I'm not you ugly.

I'm not are ugly.

Im not a ugly.

Im not JACKASS ugly.

(ure insulting urself when u read 3rd word of each sentence.)

feel insulted?

sure. ;)

i love this story.

pls read.

i know an old lady who swallowed a fly...

I dont know why she swallowed the fly, perhaps she'll die.

there was an old lady who swallowed a spider...

that wiggled and jiggled and tickled inside her,

she swallowed the spider to catch the fly,

I dont know why she swallowed the fly, perhaps she'll die.

there was an old lady who swallowed a bird...

a bird, a bird, how obsured.

she swallowed the bird to catch the spider,

she swallowed the spider to catch the fly,

I dont know why she swallowed the fly, perhaps she'll die.

there was and old lady who swallowed a cat,

well how bout that,

she swallowed a cat,

she swallowed the cat to catch the bird,

she swallowed the bird to catch the spider,

she swallowed the spider to catch the fly,

I dont know why she swallowed the fly,

perhaps she'll die.

there was and old lady who swallowed a dog,

she went whole hog when she swallowed that dog,

she swallowed the dog to catch the cat,

she swallowed the cat to catch the bird,

she swallowed the bird to catch the spider,

she swallowed the spider to catch the fly,

I dont know why she swallowed the fly, perhaps she'll die.

there was an old lady who swallowed a cow,

I dont knpow how she swallowed the cow,

she swallowed the cow to catch the dog,

she swallowed the dog to catch the cat,

she swallowed the cat to catch the bird,

she swallowed the bird to catch the spider,

she swallowed the spider to catch the fly,

I dont know why she swallowed the fly, perhaps she'll die.

thier was an old lady who swallowed a horse...

...she died of course laaa..

haha:)

what does bible stands for?

errr...

B-basic

I-instructions

B-before

L-leaving

E-earth

LoL. freaking bored.

i'm just bored so i crap a lot of stuff!

byeee.

love, jess.

Tag no. 8( the fat number)

2008-11-23T15:01:00.000+08:00

christmas is coming!

jing-a-bell.

presents =)

tagged by shuyan.

1. The last person who tagged you is:

rinrin.

2. Your relationship with him/her is:

best frens. ;)

3. Your impression of him/her is:

smart. funny. and boom de yada freak lorr...

4. The most memorable that he/she has ever done for you:

draw the angel of music thingi i guess.

5. The most memorable thing that he/she has ever said to you:

tell me that when the characters in maple bcome ghost, it will go like...ghostly.

haha.

6. If he/she becomes your lover, you will:

errr... she's lesbian meh? or am i? impossible to be lover laa. but to be sure, we love each other=)

7. If he/she becomes your lover, he/she will have to improve on:

hrm. be more romantic. (i'm totally crapping) haha.

8. If he/she becomes your enemy, the reason will be:

she tries to kill me with a spoon. haha.

9. The most desired thing you want to do for him/her is:

stop her from aboarding to the plane to sg. but it's for her own good. miss you.

10. Your overall impression on him/her is:

smart i guess.

11. How do you think people around you feel about you?

no life. =( haha. but I HAVE A LIFE! haha.

12. The character you love about yourself is:

kind, pretty, friendly and perasan.

13. On the contrary, the character you hate about yourself is:

dumb and noob.

14. The most ideal person you wanna be is:

noe herself and others well.

15. Pass the quiz on to 6 people that you wish to know how they feel about you-

1. alex. 2. clam. 3. allysha. 4.eric. 5. shuyan again lorrr. 6. james.

16. Who is number 6 (james) having a relationship with?

errr... he wan but dun have! haha. tell no one ryt.

17. What is number 2 (clam) studying about?

uni stuff i guess.

18. When was the last time you had a chat with number 3 (allysha)?

long time ago. haha

19. Does number 1 (alex) have any siblings?

nope.

20. Will you woo number 3 (allysha)?

a gal? err... nope. btw, whats woo? =.=

21. What is the surname of number 6 (james)?

chong lor.

22. What is the hobby of number 4 (eric)?

scouting i guess.

23. Where is number 2 (clam) studying at?

dunno.

24. Talk something casually about number 1 (alex)

chubby lion!

25. What colour does number 4 (eric) like?

i dunno leh. eric, what's ur fav colour?

326. Are number 1 (alex) and number 5 (james) best friends?

sure.

27. How did you get to know number 2 (clam)?

in school lorr.

28. Does number 1 (alex) have any pets?

maybe a lion in her wordrobe. lol=)

--THE END--

haha^^ happy 46th post!

2008-11-21T18:13:00.000+08:00

haha. so little post.

but its worth to celebratee to me.

cos i'm damn bored.

alex go do homework

james go tuition mania.

haha. no one to chat with.

so i google weird stuff.

and found this photo editing tools.

cool effect from photofunia.

me n bro.

this really reminds me of eyemole again.
aiks.

haha. syok sendiri je.

haha.

now= 6.20 p.m.

go watch yee nan wang. haha.

some hokkien series.

love, jess.

bye^^

nice day...

Tagged by allysha :)

2008-11-17T18:37:00.000+08:00

Rules :
- Pick your birth month .
- Strike out anything that doesn't apply to you .
- Bold (or italicize) the best apply to you .
- Copy to your own blog , with all twelve months .
- Tag 10 people

JANUARY:
Stubborn and hard-hearted. Ambitious and serious. Loves to teach and be taught. Always looking at people's flaws and weaknesses. Likes to criticize. Hardworking and productive. Smart, neat and organized. Sensitive and has deep thoughts. Knows how to make others happy. Quiet unless excited or tensed. Rather reserved. Highly attentive. Resistant to illnesses but prone to colds. Romantic but has difficulties expressing love. Loves children. Loyal. Has great social abilities yet easily jealous. Very stubborn and money cautious.

FEBRUARY:Abstract thoughts. Loves reality and abstract. Intelligent and clever. Changing personality. Attractive. Sexy. Temperamental. Quiet, shy and humble. Honest and loyal. Determined to reach goals. Loves freedom. Rebellious when restricted. Loves aggressiveness. Too sensitive and easily hurt. Gets angry really easily but does not show it. Dislikes unnecessary things. Loves making friends but rarely shows it. Daring and stubborn. Ambitious. Realizes dreams and hopes. Sharp. Loves entertainment and leisure. Romantic on the inside not outside. Superstitious and ludicrous. Spendthrift. Tries to learn to show emotions.

MARCH:Attractive personality. Sexy. Affectionate. Shy and reserved. Secretive. Naturally honest, generous and sympathetic. Loves peace and serenity. Sensitive to others. Loves to serve others. Easily angered. Trustworthy. Appreciative and returns kindness. Observant and assesses others. Revengeful. Loves to dream and fantasize. Loves travelling. Loves attention. Hasty decisions in choosing partners. Loves home decors. Musically talented. Loves special things. Moody.

APRIL:Active and dynamic. Decisive and hasty but tends to regret. Attractive and affectionate to oneself. Strong mentality. Loves attention. Diplomatic. Consoling, friendly and solves people's problems. Brave and fearless. Adventurous. Loving and caring. Suave and generous. Emotional. Aggressive. Hasty. Good memory. Moving. Motivates oneself and others. Sickness usually of the head and chest. Sexy in a way that only their lover can see.

MAY:Stubborn and hard-hearted. Strong-willed and highly motivated. Sharp thoughts. Easily angered. Attracts others and loves attention. Deep feelings. Beautiful physically and mentally. Firm Standpoint. Needs no motivation. Easily consoled. Systematic (left brain). Loves to dream. Strong clairvoyance. Understanding. Sickness usually in the ear and neck. Good imagination. Good physical. Weak breathing. Loves literature and the arts. Loves travelling. Dislike being at home. Restless. Not having many children. Hardworking. High spirited. Spendthrift.

JUNE:Thinks far with vision. Easily influenced by kindness. Polite and soft-spoken. Having ideas. Sensitive. Active mind. Hesitating, tends to delay. Choosy and always wants the best. Temperamental. Funny and humorous. Loves to joke. Good debating skills.Talk ative. Daydreamer. Friendly. Knows how to make friends. Able to show character. Easily hurt. Prone to getting colds. Loves to dress up. Easily bored. Fussy. Seldom shows emotions. Takes time to recover when hurt. Brand conscious. Executive. Stubborn.

JULY:Fun to be with. Secretive. Difficult to fathom and to be understood. Quiet unless excited or tensed. Takes pride in oneself. Has reputation. Easily consoled. Honest. Concerned about people's feelings. Tactful. Friendly. Approachable. Emotional temperamental and unpredictable. Moody and easily hurt. Witty and sparkly. Not revengeful. Forgiving but never forgets. Dislikes nonsensical and unnecessary things. Guides others physically and mentally. Sensitive and forms impressions carefully. Caring and loving. Treats others equally. Strong sense of sympathy. Wary and sharp. Judges people through observations. Hardworking. No difficulties instudy ing. Loves to be alone. Always broods about the past and the old friends. Likes to be quiet. Homely person. Waits for friends. Never looks for friends. Not aggressive unless provoked. Prone to having stomach and dieting problems. Loves to be loved. Easily hurt but takes long to recover.

AUGUST:Loves to joke. Attractive. Suave and caring. Brave and fearless. Firm and has leadership qualities. Knows how to console others. Too generous and egoistic. Takes high pride in oneself. Thirsty for praises. Extraordinary spirit. Easily angered. Angry when provoked. Easily jealous. Observant. Careful and cautious. Thinks quickly. Independent thoughts. Loves to lead and to be led. Loves to dream. Talented in the arts, music and defense. Sensitive but not petty. Poor resistance against illnesses. Learns to relax. Hasty and trusty. Romantic. Loving and caring. Loves to make friends.

(er... why is october b4 sept. nvm)
OCTOBER:Loves to chat. Loves those who loves them. Loves to take things at the center. Inner and physical beauty. Lies but doesn't pretend. Gets angry often. Treats friends importantly. Always making friends. Easily hurt but recovers easily. Daydreamer. Opinionated. Does not care of what others think. Emotional. Decisive. Strong clairvoyance. Loves to travel, the arts and literature. Touchy and easily jealous. Concerned. Loves outdoors. Just and fair. Spendthrift. Easily influenced. Easily loses confidence. Loves children

SEPTEMBER:Suave and compromising. Careful, cautious and organized. Likes to point out people's mistakes. Likes to criticize. Stubborn. Quiet but able to talk well. Calm and cool. Kind and sympathetic. Concerned and detailed. Loyal but not always honest. Does work well. Very confident. Sensitive. Good memory. Clever and knowledgeable. Loves to look for information. Must control oneself when criticizing. Able to motivate oneself. Understanding. Fun to be around. Secretive. Loves leisure and traveling. Hardly shows emotions. Tends to bottle up feelings. Very choosy, especially in relationships. Systematic.

NOVEMBER:Has a lot of ideas. Difficult to fathom. Thinks forward. Unique and brilliant. Extraordinary ideas. Sharp thinking. Fine and strong clairvoyance. Can become good doctors. Dynamic in personality. Secretive. Inquisitive. Knows how to dig secrets. Always thinking. Less talkative but amiable. Brave and generous. Patient. Stubborn and hard-hearted. If there is a will, there is a way. Determined. Never give up. Hardly becomes angry unless provoked. Loves to be alone. Thinks differently from others. Sharp-minded. Motivates oneself. Does not appreciate praises. High-spirited. Well-built and tough. Deep love and emotions. Romantic. Uncertain in relationships. Homely. Hardworking. High abilities. Trustworthy. Honest and keeps secrets. Not able to control emotions. Unpredictable.

DECEMBER:Loyal and generous. Sexy. Patriotic. Active in games and interactions. Impatient and hasty. Ambitious. Influential in organizations. Fun to be with. Loves to socialize. Loves praises. Loves attention. Loves to be loved. Honest and trustworthy. Not pretending. Short tempered. Changing personality. Not egotistic. Take high pride in oneself. Hates restrictions. Loves to joke. Good sense of humor.

i am JUNE:

Thinks far with vision.
Easily influenced by kindness.
~~Polite and soft spoken.~~
Having ideas.
Sensitive.
Active mind.
~~Hesitating, tends to delay~~
Choosy and always wants the best.
~~Temperamental~~
Funny and humorous.
Loves to joke.
~~Good debating skills~~
Talk ative.
Daydreamer.
Friendly.
Knows how to make friends.( who dun?)
Able to show character.
Easily hurt.
Prone to getting colds. ( omg. who they noe?)
Loves to dress up.
Easily bored.
Fussy.
~~Seldom shows emotions~~
Takes time to recover when hurt.
Brand conscious.
Executive.
Stubborn.

i tag... no one. haha =)
lazy.

love, jess.
bye.

Genting Trip snow world.

2008-11-17T12:16:00.000+08:00

we went to genting.

and it was lonely ad fun.

haha. lonely cos no frens to play with me.

fun cos i played a lots of things haha.

we wentto snow world too.

the snow seems quite dirty.

but it was certainyl FUN!!!

we look super fat with the clothes. haha.

love, jess.
byeee. go bath.

p/s: next time go with me ar...
haha.

rabbits <3

2008-11-17T11:46:00.000+08:00

iloverabbits=) my favourite 6 y o fren. haha. so cute!
haha. her name is qian qing.
we always feed the rabbits carrots every sat or sun.
fun time chasing rabbits in my condo. i mean our.

lovely rabbits.

haha.

my little small fren and her teddy bear.

:)

love,

jess.

bye.

Jess...The Great Brains..

2008-11-13T22:27:00.000+08:00

Yea..

I'm Not Jessica..

Haha..

From schoolmate's point of view....

1) Jessica is really kiasu..

2) Jessica is friendly!!

3) Jessica hangs out with Alex , Xin Ying , Shu Yan , and Jeiru...(so called the happy 5 friends)

4) Jessica is a trustable friend!!

5) Jessica is weird..

6) Jessica is SMART!!!

7) Jessica is quite perasan..

8) Jessica doesn't care about her phone bill..

9) Jessica love watermelon..

10) Jessica is pure RANDOM!!!

_____________________________________________________________

Owh well...

She is a good person..

Get to know her better!!!

Bye..

Sry 4 posting this..

Forgive my randomness

a trip to putrajaya

2008-11-09T21:23:00.000+08:00

b4 exam,

around 1- 2 nov,

vincent, jason, uncle james and auntie su

came for a spelling bee competition.

haha. jason won 3rd.

cos still got exam, still reading kh.

haha.

vincent, auntie su and me.

and yeah, ron's bionicle.

cuteboyz hor...

great posers!

i'm still holding a sj bk.
haha. 8D

my uncle laa.

auntie laa.

and favorite cousins.

haha. i like the background.

some nice pics from putrajaya.

the lamp pole damn weird -.-lll

is it suppose to be the prime minister's office?

haha. i duno leh

bye.

love, jess.

Last day of school( 2OO8)

2008-11-08T20:47:00.000+08:00

2 tearatai...

ku gang ar, james.

alex u look funny!

i look retarded.

what to do for last day of school?

camwhore.

haha.

the thingi that looks like sijil is the laguage house punya paper.

haha. at xy's jaga-ing place.

alex: " why me wor?"

BSMM board. nice hor.

alex finally get to be taller than us.
happy hor, alex.
sry for insulting.
we admire the tall-ness.

superman... ultraman... and someting werid. haha

haha. selamat datang!

the head kena chop by fan punya BIRD's graveyard.

haha. pity you, bird.

touchwood. it's spirit wun come out from the pic ryt...

what did jieru and me do?

why are we locked in penjara.

haha =)

ku gang. alex and me- chock

shuyan- so freaking real.

jieru- what to say( laughing?)

haha

see no evil.

hear no evil.

talk no evil?

and shushu the evil.

why so hot?

i mean warm.

ilikethispicture;)

David! so col cool pose

alex the lion's punya mane.

i mean hair.

pn chia.

and mallorie came to smdu?

unbelieveble.

dun take my pic.

i didnt delete it.

vi vian, dun kill me.

haha

can see the difference.

alex the nerd.

noob looks.

haha. noob + noob= supe noob.

alex's eye.

to b specific.

noooo. eyemole.

our whole year punya hard work.

roti canai.

read the words then u get why i took the pic.

fwens.

haha. do we look retard?

jasmine? how are you? haha.

thx for the col with yr phone, william!

xinying take de not me!

random pic by the famous xy.

tada.

sry, shuyan. you're not in the pic.

if yes, then happy 5 frens can ka hao yut yun.

haha.

xy and lx.

ram ram and tofu.

me and jieru.

aha.

me and janice.

me and alex.

alex, my best fren.

alex can be taller than jess.

and thx, albert.

our photographer of the day.

ur the most yeng!

( haha=)

year 2009 is gonna come.

s pls make new resolutions.

make new frens.

keep the old.

forgive the hurts.

be happy and enjoy ur wonderful life.

bye.

love, jess.

bon voyage, 2 Teratai.

2008-11-07T14:16:00.000+08:00

bye, 2 teratai. (2008)
"goodbye my love, wo de a ren, zai jien!"
haha.

just saw james punya blog.
so i oso blog about 2 teratai's students lor.
lol.

Alex.
funny. lioness.
loveeees BOom de yada.

hakim
quite funny and knowledgeble.
sits beside iden in class.
haha.

Faiz.
urm. play chi gu bak wif james. haha
no that close i guess.

ideen.
funny.
songs pro.
tell me that it's bum bum de not dum dum de.
haha. disturbia. oh well, thx.

Razi.
urm. i still rmb the "fark". happens last yea de.

eric.
aka erl.
funny.
got a lots of lame and racist jokes.
haha.
what do u col a black priest?

gerald.
retarded( no offence man)
super smart.
thinks an RM 3 apple as a brg larangan.
and kept it under pn tan's bag.

james.
kiasu.
parit.
jog to lose weight.
pal.

qilin.
haha. ice cream.
ass. secretary for bc society.
thx for helping.

caleb.
fast thinker.
weird in some way
smart ass.
and sj freak.

malcolm
err... teach me maths.
smart.
cool? yeah sure.

Pavithran
fat but cute. haha
impossibly smart. too much laa...
envy~

Haiqal
nas's uncle.
sing very well. and can make
those weird weird sounds.

Jieru.
fren lorr...
quite good in origami i think. nice BOX!

anith n airin
one word: quiet.

nadirah.
responsible.
urm. ideen's ahem.
haha

jess
skip my part!

Grace ling.
head prefect.
strict.
funny.
active.
oh ya, st. john.

anjelee.
urm. same height and size.
perfect.
and ass. head prefect.

wanteng.
so col ponteng.
scout freak.
dunno simpan kira.

cindi.
urm. just borrowed my phone to col her dad! haha
scared of veins.

xinying.
one of the member of the chunted choo family.
draw ramram.
cute.
and sweet.
i mean strict.

shuyan.
funny.
miss you, shushu.

vimeel.
urm. fan( in canto)
like someone. haha

jonathan.
swim well
like to read arthemis fowl.

william
sick.
horny.
scout freak.
tall.
blackmail me lorr...

yeevonne
got an eyemole.
scout freak.
funny.

isaac.
alwiz pull my pony tail.
bully me.
crycry.
oh ya, MAKE ME CRY.
stress me

reeqa.
pen ketua class.
responsible.
good conductor.

nas.
ass. head prefect.
love sponge bob.

sharmaine.
perasan.
pretty.( i tink)

najla.
$$ bendahari.
tried to wear so many watch on her hand.
haha.

whoa. lazy to blog edi.
nitezz.
love, jess.

tagged by clam

2008-11-06T20:51:00.000+08:00

1.) do u think you're hot?
urm. yeah sure.

2.) upload your favourite picture of you!

$$$$$$. i noe. money minded.

3) Why do you like that picture ?

who dun like money. haha.

4) When was the last time you ate pizza?

urm. my mom just made one. yummy! and noooo i cant go to the party at pizza. sobs.

5) The last song you listen to ?

Disturbia by rihanna. i noe u hate it, alex.

6) What are you doing right now besides this?

-loading the stupid picnik for editing pics.

- listening when ure gone.

7) What name would you prefer besides yours ?

jessxigua. lol. or even jessmelon. i love watermelon. XIGUA.

5 People to tag :)

- alex.

- shuyan.

- james c.

- eric.

- xueer.

8.) Who is number one ?

- My best fren. and yeah alex the lion. :)

9) Number three is having a relationship with ?

hrm... what to say. i dunno? haha.

10) Say something about number five ?

clever and nice hair u have. =)

11) How about number four ?

urm. funny and yeah erl.

12) Who is number two ?

urm. my best fren too. and oh nooooo...

she's gonna fly to sg 2 stdy. i miss u, shushu.

OoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoO

haha.

crazy,

nice,

boring,

memorable

and fasinating DAY!

bye,

jess.

exam is finally over

2008-11-04T21:46:00.000+08:00

e- eager to get an A
x- x-rated( lol... reminds me of x files)
a- awesome? (after exam laa)
m- mafia lol...

exam stress me out.
ya...
no more smao.
no more waking up early
no more nerd. 8D
no more STRESS.

after exam,
more games.
more novels.
more chating.
more blogging.
more shopping.
oh ya, more sleeping.

bye,
jess.

ps: nid wrap spbt bks. and tie a buka sila.
read twilight.
play swift 3.

my brother ^-^

2008-10-18T12:54:00.000+08:00

ronald is my 7 years old bro.

he is not ronald mcdonald.

lol^^

his malay penulisan got 60.

haizzz... i' super bad teacher.

crycry.

but i hope his the other malay paper can get

he just need an A.

then can buy bionicles, ps2 games...

and ya. can watch cartoon network.

haizzz...

ronald, u can do it.

then u won be a phantom.

muahaha.

bye. go study sc.

love, jess.

p/s: woot. PMR is over.

frens 4eva

2008-10-17T21:46:00.000+08:00

alex,

u r my best fren.

haha. feel honoured anot alex?

and i actually found a lion shape while editing the pic

but cant find hippo or xigua.

haizzz.

btw, i brighten the teeth!

mine and yours.

alex, thanks for being such a nice, chubby fren of mine.

alexandria the great.

bye.

love, jess.

art exam^^

2008-10-17T20:30:00.000+08:00

this is what i col random laa...

got mustache punya VAMPIRE!

aka edward's wife. jk laa.

ltr bella kill me...

does the mustache looks like potato man de?

haha.

everyone's art is so pretty!

dun ask me why my watermelon is red and green in colour.

bcos. i oso dunno.

haha^^

and thx, jieru. =D

alex's drawing is full of square flowers. and ya...

stingrays! haha

shuyan, ure drawing roxs...

bye.

love, jess.

Jessy's blog

i'm gonna blog.

caplico stick

revive :D

My biggest Mistake

Red Infusion

Hola people

I hecker

8D

Lala.

OU outing

@ school and my house

Happy Raya!

i may be suffering insomnia.

BSMM Installation 09-Drama Night.

happy belated bday shu, my best best fren! =)

whats done is done.

haha. =D damn happy.

Thanks for everything guys.

I am Jessica

7A 1B

my dad's alive

alex sudden visit.

congrats vincent! XD

check it out! XD

hope SS20 win! XD

100

happy teachers day and erm nice movie!

sry laa

Last Lust Laugh

an update =D

Wish me luck :) i'm ready to serve my best.

TAgg. Tagg. TAG

Jessica!!

kid photos

i have a fringe.

Ravel Tzigane

Happy b4 bday, sophie!

bball

which spot do u like to KISS? LOL

xigua hate watermelon for once.

fat women being horny.

weird tag.

LOL

kena april fooled!

praying.

satisfying.

Touched >.<

Tuts My Barreh.

jail jail jail... .3 times.

making my way down town.

be optimistic!

danny batu!

"wankembangcapmohorzinakempetaisaitaringanuohyaHOABINH"

having 3XAM fever ...

BSMM marching

tmr marching...

21/1/2009

Kiambang 09

ok. it's gonna be okay. ryt?

jessica LOL

Penang Trip *part 1*

merry christmas and happy new year

battleground

The Black hole.

trying stuff...

argh...

abcdefunny...

Sweet Christmas.

10 dec 2008.

erm. i like buterfly!

heights.

=)

Tag no. 8( the fat number)

haha^^ happy 46th post!

Tagged by allysha :)

Genting Trip snow world.

rabbits <3

Jess...The Great Brains..

a trip to putrajaya

Penang Trip part 1